CD43 Antibody - #DF13560
| Product: | CD43 Antibody |
| Catalog: | DF13560 |
| Description: | Rabbit polyclonal antibody to CD43 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Horse |
| Mol.Wt.: | 40kDa; 40kD(Calculated). |
| Uniprot: | P16150 |
| RRID: | AB_2846579 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13560, RRID:AB_2846579.
Fold/Unfold
CD 43; CD43; CD43 antigen; Galactoglycoprotein; GALGP; GPL 115; GPL115; Human gene for sialophorin; Leucocyte sialoglycoprotein; LEUK_HUMAN; Leukocyte large sialoglycoprotein; Leukocyte sialoglycoprotein; Leukosialin; LSN; Ly-48; sialophorin (gpL115, leukosialin, CD43); Sialophorin; Spn;
Immunogens
A synthesized peptide derived from human CD43, corresponding to a region within the internal amino acids.
Cell surface of thymocytes, T-lymphocytes, neutrophils, plasma cells and myelomas.
- P16150 LEUK_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Predominant cell surface sialoprotein of leukocytes which regulates multiple T-cell functions, including T-cell activation, proliferation, differentiation, trafficking and migration. Positively regulates T-cell trafficking to lymph-nodes via its association with ERM proteins (EZR, RDX and MSN) (By similarity). Negatively regulates Th2 cell differentiation and predisposes the differentiation of T-cells towards a Th1 lineage commitment. Promotes the expression of IFN-gamma by T-cells during T-cell receptor (TCR) activation of naive cells and induces the expression of IFN-gamma by CD4(+) T-cells and to a lesser extent by CD8(+) T-cells. Plays a role in preparing T-cells for cytokine sensing and differentiation into effector cells by inducing the expression of cytokine receptors IFNGR and IL4R, promoting IFNGR and IL4R signaling and by mediating the clustering of IFNGR with TCR. Acts as a major E-selectin ligand responsible for Th17 cell rolling on activated vasculature and recruitment during inflammation. Mediates Th17 cells, but not Th1 cells, adhesion to E-selectin. Acts as a T-cell counter-receptor for SIGLEC1 (By similarity).
Protects cells from apoptotic signals, promoting cell survival.
Glycosylated; has a high content of sialic acid and O-linked carbohydrate structures.
Phosphorylation at Ser-355 is regulated by chemokines, requires its association with ERM proteins (EZR, RDX and MSN) and is essential for its function in the regulation of T-cell trafficking to lymph nodes.
Has a high content of sialic acid and O-linked carbohydrate structures.
Cleavage by CTSG releases its extracellular domain and triggers its intramembrane proteolysis by gamma-secretase releasing the CD43 cytoplasmic tail chain (CD43-ct) which translocates to the nucleus.
Sumoylated.
Membrane>Single-pass type I membrane protein. Cell projection>Microvillus. Cell projection>Uropodium.
Note: Localizes to the uropodium and microvilli via its interaction with ERM proteins (EZR, RDX and MSN).
Nucleus. Nucleus>PML body.
Cell surface of thymocytes, T-lymphocytes, neutrophils, plasma cells and myelomas.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs). (View pathway)
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.