Product: KIR2DL4 Antibody
Catalog: DF13591
Description: Rabbit polyclonal antibody to KIR2DL4
Application: WB IHC IF/ICC
Reactivity: Human, Rat
Mol.Wt.: 41kDa,28kDa; 41kD(Calculated).
Uniprot: Q99706
RRID: AB_2846610

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500, WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Rat
Clonality:
Polyclonal
Specificity:
KIR2DL4 Antibody detects endogenous levels of total KIR2DL4.
RRID:
AB_2846610
Cite Format: Affinity Biosciences Cat# DF13591, RRID:AB_2846610.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CD_antigen=CD158d; CD158 antigen like family member D; CD158 antigen-like family member D; CD158d; G9P; KI2L4_HUMAN; Killer cell immunoglobulin like receptor 2DL4; Killer cell immunoglobulin like receptor, two domains, long cytoplasmic tail, 4; Killer cell immunoglobulin-like receptor 2DL4; Killer cell inhibitory receptor 103AS; Killer Ig receptor; KIR 103AS; KIR-103AS; KIR103; KIR103AS; KIR2DL4; MHC class I NK cell receptor KIR103AS; Natural killer cell inhibitory receptor; NK cell receptor; NK cell receptor; natural killer cell inhibitory receptor; OTTHUMP00000068612; OTTHUMP00000068614; OTTHUMP00000068615;

Immunogens

Immunogen:

A synthesized peptide derived from human KIR2DL4, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q99706 KI2L4_HUMAN:

Expressed in decidual NK cells and innate lymphoid cell type I (ILC1) (PubMed:29262349). Expressed in a subset of peripheral NK cells (PubMed:19304799).

Sequence:
MSMSPTVIILACLGFFLDQSVWAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRAGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDPSDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHRWCSKKKDAAVMNQEPAGHRTVNREDSDEQDPQEVTYAQLDHCIFTQRKITGPSQRSKRPSTDTSVCIELPNAEPRALSPAHEHHSQALMGSSRETTALSQTQLASSNVPAAGI

Research Backgrounds

Function:

Receptor for non-classical major histocompatibility class Ib HLA-G molecules. Recognizes HLA-G in complex with B2M/beta-2 microglobulin and a nonamer self-peptide (peptide-bound HLA-G-B2M). In decidual NK cells, binds peptide-bound HLA-G-B2M complex and triggers NK cell senescence-associated secretory phenotype as a molecular switch to promote vascular remodeling and fetal growth in early pregnancy. May play a role in balancing tolerance and antiviral-immunity at maternal-fetal interface by keeping in check the effector functions of NK, CD8+ T cells and B cells. Upon interaction with peptide-bound HLA-G-B2M, initiates signaling from the endosomal compartment leading to downstream activation of PRKDC-XRCC5 and AKT1, and ultimately triggering NF-kappa-B-dependent proinflammatory response.

Subcellular Location:

Cell membrane>Single-pass type I membrane protein. Early endosome membrane.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in decidual NK cells and innate lymphoid cell type I (ILC1). Expressed in a subset of peripheral NK cells.

Family&Domains:

Belongs to the immunoglobulin superfamily.

Research Fields

· Cellular Processes > Cell growth and death > Cellular senescence.   (View pathway)

· Organismal Systems > Immune system > Antigen processing and presentation.   (View pathway)

· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.