FOXF2 Antibody - #DF13619
| Product: | FOXF2 Antibody |
| Catalog: | DF13619 |
| Description: | Rabbit polyclonal antibody to FOXF2 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Rabbit, Dog |
| Mol.Wt.: | 45kDa; 46kD(Calculated). |
| Uniprot: | Q12947 |
| RRID: | AB_2846638 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13619, RRID:AB_2846638.
Fold/Unfold
FKH L6; FKHL 6; FKHL6; Forkhead box F2; Forkhead box protein F2; Forkhead like 6; Forkhead related activator 2; Forkhead related protein FKHL6; Forkhead related transcription factor 2; Forkhead, Drosophila, homolog-like 6; FOX F2; FOXF 2; FREAC 2; FREAC2; OTTHUMP00000017863;
Immunogens
Lung and placenta (PubMed:8626802). Predominantly expressed in gastrointestinal tract including stomach (PubMed:29374064).
- Q12947 FOXF2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTTEGGPPPAPLRRACSPVPGALQAALMSPPPAAAAAAAAAPETTSSSSSSSSASCASSSSSSNSASAPSAACKSAGGGGAGAGSGGAKKASSGLRRPEKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPMYHRVVSGLGFGASLLPQGFDFQAPPSAPLGCHSQGGYGGLDMMPAGYDAGAGAPSHAHPHHHHHHHVPHMSPNPGSTYMASCPVPAGPGGVGAAGGGGGGDYGPDSSSSPVPSSPAMASAIECHSPYTSPAAHWSSPGASPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCVM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q12947 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S85 | Phosphorylation | Uniprot | |
| S104 | Phosphorylation | Uniprot | |
| S153 | Phosphorylation | Uniprot | |
| K160 | Acetylation | Uniprot | |
| K160 | Sumoylation | Uniprot | |
| K160 | Ubiquitination | Uniprot | |
| K163 | Acetylation | Uniprot | |
| K204 | Acetylation | Uniprot | |
| K350 | Sumoylation | Uniprot |
Research Backgrounds
Probable transcription activator for a number of lung-specific genes. Mediates up-regulation of the E3 ligase IRF2BPL and drives ubiquitination and degradation of CTNNB1.
Nucleus.
Lung and placenta. Predominantly expressed in gastrointestinal tract including stomach.
Interacts with the transcription factors TBP and TFIIB.
Two activation domains, AD1 and AD2, C-terminal of (and distinct from) the forkhead domains are necessary for transcriptional activation.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.