| Product: | Dcp2 Antibody |
| Catalog: | DF13625 |
| Description: | Rabbit polyclonal antibody to Dcp2 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Horse, Sheep, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 48kDa, 60 kDa(Observed); 48kD(Calculated). |
| Uniprot: | Q8IU60 |
| RRID: | AB_2846644 |
Control Products
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13625, RRID:AB_2846644.
Fold/Unfold
DCP2; DCP2 decapping enzyme homolog (S. cerevisiae); DCP2, S. cerevisiae, homolog of; DCP2_HUMAN; decapping enzyme 2, S. cerevisiae, homolog of; decapping enzyme homolog (S. cerevisiae); FLJ33245; hDpc; m7GpppN-mRNA hydrolase; mRNA decapping enzyme 2; mRNA-decapping enzyme 2; Nucleoside diphosphate-linked moiety X motif 20; nudix (nucleoside diphosphate linked moiety X)-type motif 20; Nudix motif 20; NUDT20;
Immunogens
A synthesized peptide derived from human Dcp2, corresponding to a region within the internal amino acids.
- Q8IU60 DCP2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKNQSMRGNGRKQYQDSPNQKKRTNGLQPAKQQNSLMKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Decapping metalloenzyme that catalyzes the cleavage of the cap structure on mRNAs. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Plays a role in replication-dependent histone mRNA degradation. Has higher activity towards mRNAs that lack a poly(A) tail. Has no activity towards a cap structure lacking an RNA moiety. The presence of a N(6)-methyladenosine methylation at the second transcribed position of mRNAs (N(6),2'-O-dimethyladenosine cap; m6A(m)) provides resistance to DCP2-mediated decapping. Blocks autophagy in nutrient-rich conditions by repressing the expression of ATG-related genes through degradation of their transcripts.
Phosphorylated at ser-249 in a MTOR-dependent manner.
Cytoplasm>P-body. Nucleus.
Note: Predominantly cytoplasmic, in processing bodies (PB) (PubMed:15273322). A minor amount is nuclear (PubMed:15273322).
Expressed in brain and testis. Not detected in heart (at protein level).
Belongs to the Nudix hydrolase family. DCP2 subfamily.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > RNA degradation.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.