AIMP3/p18 Antibody - #DF13629
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13629, RRID:AB_2846648.
Fold/Unfold
AIMP 3; AIMP3; Aminoacyl tRNA synthetase complex interacting multifunctional protein 3; Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3; ARS interacting multifunctional protein 3; EEF1E1; Elongation factor p18; Eukaryotic translation elongation factor 1 epsilon 1; Eukaryotic translation elongation factor 1 epsilon-1; Homolog of rat elongation factor p18; MCA3_HUMAN; Multisynthase complex auxiliary component p18; Multisynthetase complex auxiliary component p18; p18; p18 component of aminoacyl tRNA synthetase complex;
Immunogens
- O43324 MCA3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O43324 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S8 | Phosphorylation | Uniprot | |
| K12 | Acetylation | Uniprot | |
| K12 | Ubiquitination | Uniprot | |
| S13 | Phosphorylation | Uniprot | |
| K18 | Ubiquitination | Uniprot | |
| K21 | Acetylation | Uniprot | |
| Y22 | Phosphorylation | Uniprot | |
| S23 | Phosphorylation | Uniprot | |
| K53 | Ubiquitination | Uniprot | |
| K57 | Ubiquitination | Uniprot | |
| Y59 | Phosphorylation | Uniprot | |
| K68 | Ubiquitination | Uniprot | |
| K88 | Ubiquitination | Uniprot | |
| Y101 | Phosphorylation | Uniprot | |
| K138 | Acetylation | Uniprot | |
| K166 | Acetylation | Uniprot | |
| R168 | Methylation | Uniprot |
Research Backgrounds
Positive modulator of ATM response to DNA damage.
Cytoplasm. Cytoplasm>Cytosol. Nucleus.
Note: Cytoplasmic under growth arrest conditions. Translocated into the nucleus when growth resumes (S phase) and following DNA damage.
Down-regulated in various cancer tissues.
Part of a multisubunit complex that groups tRNA ligases for Arg (RARS1), Asp (DARS1), Gln (QARS1), Ile (IARS1), Leu (LARS1), Lys (KARS1), Met (MARS1) the bifunctional ligase for Glu and Pro (EPRS1) and the auxiliary subunits AIMP1/p43, AIMP2/p38 and EEF1E1/p18. Can interact simultaneously with MARS1 and EPRS1. Forms a linear complex that contains MARS1, EEF1E1, EPRS1 and AIMP2 that is at the core of the multisubunit complex. Interacts with ATM and ATR. The interaction with ATM, which takes place independently of TP53, is induced by DNA damage that may occur during genotoxic stress or cell growth. The interaction with ATR is enhanced by UV irradiation.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.