Connexin 40 / GJA5 Antibody - #DF13633
Product: | Connexin 40 / GJA5 Antibody |
Catalog: | DF13633 |
Description: | Rabbit polyclonal antibody to Connexin 40 / GJA5 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Dog |
Mol.Wt.: | 40kDa; 40kD(Calculated). |
Uniprot: | P36382 |
RRID: | AB_2846652 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13633, RRID:AB_2846652.
Fold/Unfold
Connexin 40; Connexin 40 / GJA5; Connexin-40; Cx40; CXA5_HUMAN; Gap junction alpha 5 protein; Gap junction alpha-5 protein; Gap junction protein alpha 5 40kD (connexin 40); Gap junction protein alpha 5; Gja5; MGC11185;
Immunogens
A synthesized peptide derived from human Connexin 40 / GJA5, corresponding to a region within C-terminal amino acids.
- P36382 CXA5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGDWSFLGNFLEEVHKHSTVVGKVWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGCQNVCYDQAFPISHIRYWVLQIIFVSTPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSCWEEGNGRIALQGTLLNTYVCSILIRTTMEVGFIVGQYFIYGIFLTTLHVCRRSPCPHPVNCYVSRPTEKNVFIVFMLAVAALSLLLSLAELYHLGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Cell membrane>Multi-pass membrane protein. Cell junction>Gap junction.
Belongs to the connexin family. Alpha-type (group II) subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.