SDCCAG3 Antibody - #DF13676
| Product: | SDCCAG3 Antibody |
| Catalog: | DF13676 |
| Description: | Rabbit polyclonal antibody to SDCCAG3 |
| Application: | WB IHC |
| Reactivity: | Human, Rat |
| Mol.Wt.: | 47kDa; 48kD(Calculated). |
| Uniprot: | Q96C92 |
| RRID: | AB_2846695 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13676, RRID:AB_2846695.
Fold/Unfold
Antigen NY CO 3; NY CO 3; NY-CO-3; OTTHUMP00000022582; SDCCAG 3; Serologically defined colon cancer antigen 3;
Immunogens
A synthesized peptide derived from human SDCCAG3, corresponding to a region within N-terminal amino acids.
- Q96C92 ENTR1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSGYQRRPGATPLSRARSLAIPDAPAFYERRSCLPQLNCERPHGRDLDSPFFGIRPAFMCYVPSPVLASVGDTDFGYGKGKCSKQSPSGAHGTHFGDDRFEDLEEANPFSFREFLKTKNLGLSKEDPASRIYAKEASRHSLGLDHNSPPSQTGGYGLEYQQPFFEDPTGAGDLLDEEEDEDTGWSGAYLPSAIEQTHPERVPAGTSPCSTYLSFFSTPSELAGPESLPSWALSDTDSRVSPASPAGSPSADFAVHGESLGDRHLRTLQISYDALKDENSKLRRKLNEVQSFSEAQTEMVRTLERKLEAKMIKEESDYHDLESVVQQVEQNLELMTKRAVKAENHVVKLKQEISLLQAQVSNFQRENEALRCGQGASLTVVKQNADVALQNLRVVMNSAQASIKQLVSGAETLNLVAEILKSIDRISEVKDEEEDS
Research Backgrounds
Endosome-associated protein that plays a role in membrane receptor sorting, cytokinesis and ciliogenesis. Involved in the endosome-to-plasma membrane trafficking and recycling of SNX27-retromer-dependent cargo proteins, such as GLUT1. Involved in the regulation of cytokinesis; the function may involve PTPN13 and GIT1. Plays a role in the formation of cilia. Involved in cargo protein localization, such as PKD2, at primary cilia. Involved in the presentation of the tumor necrosis factor (TNF) receptor TNFRSF1A on the cell surface, and hence in the modulation of the TNF-induced apoptosis (By similarity).
Phosphorylated.
Cytoplasm. Early endosome. Endosome. Recycling endosome. Midbody. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cytoplasm>Cytoskeleton>Cilium basal body.
Note: Colocalizes in a WASHC2-dependent manner with the retromer CSC complex at endosomes (PubMed:25278552). During cytokinesis colocalized with PTPN13 at the midbody (PubMed:23108400). Colocalizes with IFT88 and gamma-tubulin at the basal body of primary cilia (PubMed:27767179). Colocalizes with IFT88 and pericentrin at the centrosome (PubMed:27767179).
Expressed in the colon (at protein level).
Tne N-terminal domain is necessary and sufficient for basal body localization and ciliogenesis.
Belongs to the ENTR1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.