FMRFamide Antibody - #DF13684
Product: | FMRFamide Antibody |
Catalog: | DF13684 |
Description: | Rabbit polyclonal antibody to FMRFamide |
Application: | WB |
Reactivity: | Human |
Mol.Wt.: | 12kDa; 12kD(Calculated). |
Uniprot: | O15130 |
RRID: | AB_2846703 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13684, RRID:AB_2846703.
Fold/Unfold
FMFRamide related peptide precursor; FMRFAL; FMRFamide related peptides precursor; Neuropeptide FF amide peptide precursor; NPFF; NPFF protein;
Immunogens
- O15130 NPFF_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSAEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK
Research Backgrounds
Morphine modulating peptides. Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas. Neuropeptide FF potentiates and sensitizes ASIC1 and ASIC3 channels.
Secreted.
Belongs to the FARP (FMRFamide related peptide) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.