C7orf59 Antibody - #DF13696
Product: | C7orf59 Antibody |
Catalog: | DF13696 |
Description: | Rabbit polyclonal antibody to C7orf59 |
Application: | WB IHC |
Reactivity: | Human, Rat |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
Mol.Wt.: | 10kDa; 11kD(Calculated). |
Uniprot: | Q0VGL1 |
RRID: | AB_2846715 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13696, RRID:AB_2846715.
Fold/Unfold
AV006840; C7orf59; CG059_HUMAN; Chromosome 7 open reading frame 59; Late endosomal/lysosomal adaptor and MAPK and MTOR activator 4; Ragulator complex protein LAMTOR4; UPF0539 protein C7orf59;
Immunogens
A synthesized peptide derived from human C7orf59, corresponding to a region within the internal amino acids.
- Q0VGL1 LTOR4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated.
Lysosome.
Belongs to the LAMTOR4 family.
Research Fields
· Environmental Information Processing > Signal transduction > mTOR signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.