EB3 Antibody - #DF13698
| Product: | EB3 Antibody |
| Catalog: | DF13698 |
| Description: | Rabbit polyclonal antibody to EB3 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
| Mol.Wt.: | 31kDa; 32kD(Calculated). |
| Uniprot: | Q9UPY8 |
| RRID: | AB_2846717 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13698, RRID:AB_2846717.
Fold/Unfold
APC binding protein; EB 3; EB1 protein family member 3; EB3; EBF 3; EBF3; EBF3 S; End binding protein 3; End-binding protein 3; MAPRE 3; MAPRE3; MARE3_HUMAN; Member 3; Microtubule Associated Protein; Microtubule associated protein RP/EB family member 3; Microtubule-associated protein RP/EB family member 3; OTTHUMP00000200910; RP 3; RP/EB Family; RP3;
Immunogens
- Q9UPY8 MARE3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UPY8 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K66 | Ubiquitination | Uniprot | |
| K83 | Acetylation | Uniprot | |
| K113 | Ubiquitination | Uniprot | |
| Y119 | Phosphorylation | Uniprot | |
| T155 | Phosphorylation | Uniprot | |
| T161 | Phosphorylation | Uniprot | |
| S162 | Phosphorylation | Uniprot | |
| T164 | Phosphorylation | Uniprot | |
| S176 | Phosphorylation | O14965 (AURKA) , Q96GD4 (AURKB) | Uniprot |
| K229 | Ubiquitination | Uniprot |
Research Backgrounds
Plus-end tracking protein (+TIP) that binds to the plus-end of microtubules and regulates the dynamics of the microtubule cytoskeleton. Promotes microtubule growth. May be involved in spindle function by stabilizing microtubules and anchoring them at centrosomes. Also acts as a regulator of minus-end microtubule organization: interacts with the complex formed by AKAP9 and PDE4DIP, leading to recruit CAMSAP2 to the Golgi apparatus, thereby tethering non-centrosomal minus-end microtubules to the Golgi, an important step for polarized cell movement. Promotes elongation of CAMSAP2-decorated microtubule stretches on the minus-end of microtubules. May play a role in cell migration (By similarity).
Cytoplasm>Cytoskeleton.
Note: Associated with the microtubule network. Detected at the plus end of microtubules.
Predominantly expressed in brain and muscle.
Interacts with APC2. Homodimer. Heterodimer with MAPRE1. Interacts with DCTN1 and SRCIN1. Binds to the C-terminal domain of APC. Binds monomeric and polymerized tubulin. Interacts (via C-terminus) with CLIP1. Interacts with SLAIN2 and SLAIN1. Interacts with AKAP9. Interacts with PDE4DIP. Interacts with PDE4DIP isoform 13/MMG8/SMYLE; this interaction is required for its recruitment to the Golgi apparatus.
Composed of two functionally independent domains. The N-terminal domain forms a hydrophobic cleft involved in microtubule binding and the C-terminal is involved in the formation of mutually exclusive complexes with APC and DCTN1.
Belongs to the MAPRE family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.