HOXA4 Antibody - #DF13701
| Product: | HOXA4 Antibody |
| Catalog: | DF13701 |
| Description: | Rabbit polyclonal antibody to HOXA4 |
| Application: | WB IHC |
| Reactivity: | Human |
| Prediction: | Pig, Dog |
| Mol.Wt.: | 34kDa; 34kD(Calculated). |
| Uniprot: | Q00056 |
| RRID: | AB_2846720 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13701, RRID:AB_2846720.
Fold/Unfold
Dfd like protein; Homeo box A4; Homeobox A4; Homeobox protein Hox-1.4; Homeobox protein Hox-1D; Homeobox protein Hox-A4; Hox 1.4 like protein; hox-1.4; hox-1d; HOX1; HOX1D; HOXA4; HXA4_HUMAN;
Immunogens
- Q00056 HXA4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTMSSFLINSNYIEPKFPPFEEYAQHSGSGGADGGPGGGPGYQQPPAPPTQHLPLQQPQLPHAGGGREPTASYYAPRTAREPAYPAAALYPAHGAADTAYPYGYRGGASPGRPPQPEQPPAQAKGPAHGLHASHVLQPQLPPPLQPRAVPPAAPRRCEAAPATPGVPAGGSAPACPLLLADKSPLGLKGKEPVVYPWMKKIHVSAVNPSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTKMRSSNSASASAGPPGKAQTQSPHLHPHPHPSTSTPVPSSI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q00056 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S109 | Phosphorylation | Uniprot | |
| Y210 | Phosphorylation | Uniprot | |
| R238 | Methylation | Uniprot | |
| Y239 | Phosphorylation | Uniprot | |
| S286 | Phosphorylation | Uniprot | |
| S288 | Phosphorylation | Uniprot | |
| S290 | Phosphorylation | Uniprot |
Research Backgrounds
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Binds to sites in the 5'-flanking sequence of its coding region with various affinities. The consensus sequences of the high and low affinity binding sites are 5'-TAATGA[CG]-3' and 5'-CTAATTTT-3'.
Nucleus.
Embryonic nervous system.
Belongs to the Antp homeobox family. Deformed subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.