DERL2 Antibody - #DF13711
Product: | DERL2 Antibody |
Catalog: | DF13711 |
Description: | Rabbit polyclonal antibody to DERL2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 27kDa; 28kD(Calculated). |
Uniprot: | Q9GZP9 |
RRID: | AB_2846730 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13711, RRID:AB_2846730.
Fold/Unfold
Carcinoma related; CGI 101; Degradation in endoplasmic reticulum protein 2; DER 2; Der1 like domain family member 2; Der1-like protein 2; DER2; DERL 2; DERL2; DERL2_HUMAN; Derlin 2; Derlin-2; Derlin2; DERtrin 2; DERtrin-2; DERtrin2; F LAN 1; F LANa; F-LAN-1; F-LANa; FLANa;
Immunogens
A synthesized peptide derived from human DERL2, corresponding to a region within C-terminal amino acids.
- Q9GZP9 DERL2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLVFLGQAFTIMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLEDVFPNQPGGIRILKTPSILKAIFDTPDEDPNYNPLPEERPGGFAWGEGQRLGG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal glycoproteins, but not that of misfolded nonglycoproteins. May act by forming a channel that allows the retrotranslocation of misfolded glycoproteins into the cytosol where they are ubiquitinated and degraded by the proteasome. May mediate the interaction between VCP and misfolded glycoproteins. May also be involved in endoplasmic reticulum stress-induced pre-emptive quality control, a mechanism that selectively attenuates the translocation of newly synthesized proteins into the endoplasmic reticulum and reroutes them to the cytosol for proteasomal degradation.
(Microbial infection) In contrast to DERL1, it is not involved in the degradation of MHC class I heavy chains following infection by cytomegaloviruses.
Endoplasmic reticulum membrane>Multi-pass membrane protein.
Ubiquitous. Overexpressed in various hepatocarcinomas.
Belongs to the derlin family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.