NOP10 Antibody - #DF13720
| Product: | NOP10 Antibody |
| Catalog: | DF13720 |
| Description: | Rabbit polyclonal antibody to NOP10 |
| Application: | WB |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog |
| Mol.Wt.: | 7kDa; 8kD(Calculated). |
| Uniprot: | Q9NPE3 |
| RRID: | AB_2846739 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13720, RRID:AB_2846739.
Fold/Unfold
DKCB1; H/ACA ribonucleoprotein complex subunit 3; homolog of yeast Nop10p; MGC70651; NOLA3; NOP10; NOP10 ribonucleoprotein homolog (yeast); NOP10_HUMAN; NOP10P; Nucleolar protein 10; Nucleolar protein family A member 3; nucleolar protein family A, member 3 (H/ACA small nucleolar RNPs); snoRNP protein NOP10;
Immunogens
A synthesized peptide derived from human NOP10, corresponding to a region within the internal amino acids.
- Q9NPE3 NOP10_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ('psi') residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme.
Nucleus>Nucleolus. Nucleus>Cajal body.
Note: Also localized to Cajal bodies (coiled bodies).
Belongs to the NOP10 family.
Research Fields
· Genetic Information Processing > Translation > Ribosome biogenesis in eukaryotes.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.