UXT Antibody - #DF13721
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13721, RRID:AB_2846740.
Fold/Unfold
Androgen receptor trapped clone 27 protein; ART 27; ART-27; OTTHUMP00000023226; OTTHUMP00000023227; Protein UXT; SKP2 associated alpha PFD 1; STAP1; Ubiquitously expressed prefoldin like chaperone; Ubiquitously expressed transcript; Ubiquitously expressed transcript protein; Uxt; UXT_HUMAN;
Immunogens
Ubiquitous (PubMed:10087202, PubMed:11854421, PubMed:17635584, PubMed:11827465). Expressed in prostate epithelial cells (PubMed:21730289). Expressed in mammary epithelial cells (PubMed:28106301). Highest levels in the heart, skeletal muscle, pancreas, kidney, liver, adrenal gland, peripheral blood leukocytes, lymph node, prostate, and thyroid and the lowest levels in bladder and uterus (PubMed:11854421, PubMed:17635584, PubMed:11827465). Overexpressed in a number of tumor tissues (PubMed:11854421, PubMed:16221885, PubMed:28106301).
- Q9UBK9 UXT_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UBK9 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T3 | Phosphorylation | Uniprot | |
| K16 | Ubiquitination | Uniprot | |
| K41 | Ubiquitination | Uniprot | |
| Y43 | Phosphorylation | Uniprot | |
| K48 | Ubiquitination | Uniprot | |
| K113 | Ubiquitination | Uniprot | |
| S115 | Phosphorylation | Uniprot | |
| K126 | Ubiquitination | Uniprot | |
| K154 | Ubiquitination | Uniprot |
Research Backgrounds
Involved in gene transcription regulation. Acts in concert with the corepressor URI1 to regulate androgen receptor AR-mediated transcription. Together with URI1, associates with chromatin to the NKX3-1 promoter region. Negatively regulates the transcriptional activity of the estrogen receptor ESR1 by inducing its translocation into the cytoplasm. May act as nuclear chaperone that facilitates the formation of the NF-kappa-B enhanceosome and thus positively regulates NF-kappa-B transcription activity. Potential component of mitochondrial-associated LRPPRC, a multidomain organizer that potentially integrates mitochondria and the microtubular cytoskeleton with chromosome remodeling. Increasing concentrations of UXT contributes to progressive aggregation of mitochondria and cell death potentially through its association with LRPPRC. Suppresses cell transformation and it might mediate this function by interaction and inhibition of the biological activity of cell proliferation and survival stimulatory factors like MECOM.
Plays a role in protecting cells against TNF-alpha-induced apoptosis by preventing the recruitment of FADD and caspase 8 to the apoptotic complex I, composed of TRADD, TRAF2 and RIPK1/RIP.
Cytoplasm.
Cytoplasm. Nucleus. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cytoplasm>Cytoskeleton>Spindle pole.
Note: Predominantly localizes to the nucleus (PubMed:16221885). Localizes to spindle pole during mitosis (PubMed:16221885).
Ubiquitous. Expressed in prostate epithelial cells. Expressed in mammary epithelial cells. Highest levels in the heart, skeletal muscle, pancreas, kidney, liver, adrenal gland, peripheral blood leukocytes, lymph node, prostate, and thyroid and the lowest levels in bladder and uterus. Overexpressed in a number of tumor tissues.
Homohexamer. Interacts with LRPPRC. Interacts with androgen receptor AR (via N-terminus). Interacts with estrogen receptor ESR1; the interaction relocalizes ESR1 from the nucleus to the cytoplasm. In the nucleus, interacts specifically with RELA (via RHD domain) and forms a dynamic complex with NF-kappa-B and is recruited to the NF-kappa-B enhanceosome upon stimulation. Interacts with MECOM. Interacts with URI1. Isoform 1 is part of complex I composed of TNF-alpha receptor TNFRSF1A, TRADD, TRAF2 and RIPK1 formed in response to TNF-alpha stimulation. Within the complex, interacts (via TPQE motif) with TRAF2; the interaction prevents the recruitment of FADD and CASP8/caspase 8 to complex I.
Belongs to the UXT family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.