| Product: | Hippocalcin Antibody |
| Catalog: | DF13752 |
| Description: | Rabbit polyclonal antibody to Hippocalcin |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
| Mol.Wt.: | 22kDa, 18 kDa(Observed); 22kD(Calculated). |
| Uniprot: | P84074 |
| RRID: | AB_2846771 |
Control Products
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13752, RRID:AB_2846771.
Fold/Unfold
BDR 2; BDR2; Calcium binding protein BDR 2; Calcium binding protein BDR2; Calcium-binding protein BDR-2; HPCA; HPCA_HUMAN; Neuron specific calcium binding protein hippocalcin; Neuron-specific calcium-binding protein hippocalcin; P23K;
Immunogens
A synthesized peptide derived from human Hippocalcin, corresponding to a region within the internal amino acids.
- P84074 HPCA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Calcium-binding protein that may play a role in the regulation of voltage-dependent calcium channels. May also play a role in cyclic-nucleotide-mediated signaling through the regulation of adenylate and guanylate cyclases (By similarity).
Myristoylation facilitates association with membranes.
Cytoplasm>Cytosol. Membrane>Peripheral membrane protein.
Note: Association with membranes is calcium-dependent (By similarity). Enriched in the perinuclear region, probably at the trans Golgi network in response to calcium (PubMed:28398555).
Brain specific.
Binds 3 calcium via EF-hand domains. The cryptic EF-hand 1 does not bind calcium.
Belongs to the recoverin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.