Product: CSTB Antibody
Catalog: AF0256
Description: Rabbit polyclonal antibody to CSTB
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Sheep, Rabbit, Dog
Mol.Wt.: 11kDa; 11kD(Calculated).
Uniprot: P04080
RRID: AB_2833431

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC: 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(83%), Bovine(83%), Sheep(83%), Rabbit(83%), Dog(100%)
Clonality:
Polyclonal
Specificity:
CSTB Antibody detects endogenous levels of total CSTB.
RRID:
AB_2833431
Cite Format: Affinity Biosciences Cat# AF0256, RRID:AB_2833431.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CHROW21; CPI B; CPI-B; CST 6; CST6; CSTB; Cystatin B (stefin B); Cystatin B; Cystatin-B; CYTB; CYTB_HUMAN; EPM1; EPM1A; Liver thiol proteinase inhibitor; PME; Stefin-B; STF B; STFB; ULD;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
CSTB This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B. Belongs to the cystatin family. Able to form dimers stabilized by noncovalent forces.
Sequence:
MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Dog
100
Pig
83
Bovine
83
Sheep
83
Rabbit
83
Chicken
75
Xenopus
44
Horse
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P04080 As Substrate

Site PTM Type Enzyme
M1 Acetylation
S7 Phosphorylation
T9 Phosphorylation
T16 Phosphorylation
K39 Ubiquitination
K44 Acetylation
K44 Ubiquitination
S45 Phosphorylation
T51 Phosphorylation
Y53 Phosphorylation
R68 Methylation
S72 Phosphorylation
K78 Acetylation
K78 Ubiquitination
S83 Phosphorylation
K91 Acetylation
K91 Ubiquitination
T96 Phosphorylation
Y97 Phosphorylation

Research Backgrounds

Function:

This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B.

Subcellular Location:

Cytoplasm. Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Able to form dimers stabilized by noncovalent forces.

Family&Domains:

Belongs to the cystatin family.

References

1). Dissecting the single-cell transcriptome network underlying esophagus non-malignant tissues and esophageal squamous cell carcinoma. eBioMedicine (PubMed: 34192657) [IF=11.1]

Application: IF/ICC    Species: Rabbit    Sample: epithelial cells

Fig. 3. The single-cell transcriptomes of epithelial cells in non-malignant and malignant esophagus.(a) The TSNE plot and overview of epithelial cells by the cell type and origin of the cells. (b) Canonical cell markers were used to label epithelial subtypes as represented in the TSNE plot. (c) The TSNE plot of epithelial cells by the CNV’s levels of the cells. (d) Heatmap showing the expression of marker genes in malignant and non-malignant epithelial cells. (e) Violin plots showing the marker genes for each epithelial cell type. (f) Immunofluorescence staining of tumor (n = 8) (up) / normal (n = 8) (down) tissue-specific genes in ESCC and non-malignant tissues. Comparison of non-malignant and malig- nant esophagus was performed by Wilcoxon test. (g) Pseudotime analysis for malignant and non-malignant epithelial cells. (h) Differences in pathway activities scored per cell by GSVA between malignant and non-malignant epithelial cells. The scores of pathways are normalized.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.