Phospho-PBK/TOPK (Ser32) Antibody - #AF3556
Product: | Phospho-PBK/TOPK (Ser32) Antibody |
Catalog: | AF3556 |
Description: | Rabbit polyclonal antibody to Phospho-PBK/TOPK (Ser32) |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 36kD(Calculated). |
Uniprot: | Q96KB5 |
RRID: | AB_2846870 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF3556, RRID:AB_2846870.
Fold/Unfold
Cancer/testis antigen 84; CT84; Epididymis luminal protein 164; FLJ14385; HEL164; Lymphokine activated killer T cell originated protein kinase; Lymphokine-activated killer T-cell-originated protein kinase; MAPKK like protein kinase; MAPKK-like protein kinase; Nori 3; Nori-3; Nori3; PBK; PDZ binding kinase; PDZ-binding kinase; Serine/threonine protein kinase; Spermatogenesis related protein kinase; Spermatogenesis-related protein kinase; SPK; T LAK cell originated protein kinase; T-LAK cell-originated protein kinase; TOPK; TOPK_HUMAN;
Immunogens
A synthesized peptide derived from human PBK/TOPK around the phosphorylation site of Ser32.
Expressed in the testis and placenta. In the testis, restrictedly expressed in outer cell layer of seminiferous tubules.
- Q96KB5 TOPK_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
PTMs - Q96KB5 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
S5 | Phosphorylation | Uniprot | |
K8 | Sumoylation | Uniprot | |
K8 | Ubiquitination | Uniprot | |
T9 | Phosphorylation | P06493 (CDK1) | Uniprot |
S11 | Phosphorylation | Uniprot | |
K12 | Acetylation | Uniprot | |
K12 | Sumoylation | Uniprot | |
K12 | Ubiquitination | Uniprot | |
S14 | Phosphorylation | Uniprot | |
K16 | Acetylation | Uniprot | |
K17 | Acetylation | Uniprot | |
S19 | Phosphorylation | Uniprot | |
S23 | Phosphorylation | Uniprot | |
T24 | Phosphorylation | Uniprot | |
T26 | Phosphorylation | Uniprot | |
S32 | Phosphorylation | Uniprot | |
Y47 | Phosphorylation | Uniprot | |
K50 | Ubiquitination | Uniprot | |
S52 | Phosphorylation | Uniprot | |
S57 | Phosphorylation | Uniprot | |
S59 | Phosphorylation | Uniprot | |
K64 | Acetylation | Uniprot | |
K64 | Sumoylation | Uniprot | |
K64 | Ubiquitination | Uniprot | |
K65 | Sumoylation | Uniprot | |
K65 | Ubiquitination | Uniprot | |
Y74 | Phosphorylation | P12931 (SRC) | Uniprot |
S76 | Phosphorylation | Uniprot | |
Y78 | Phosphorylation | Uniprot | |
K80 | Ubiquitination | Uniprot | |
K87 | Acetylation | Uniprot | |
K87 | Ubiquitination | Uniprot | |
K90 | Ubiquitination | Uniprot | |
S91 | Phosphorylation | Uniprot | |
Y100 | Phosphorylation | Uniprot | |
S122 | Phosphorylation | Uniprot | |
K132 | Ubiquitination | Uniprot | |
K155 | Sumoylation | Uniprot | |
K155 | Ubiquitination | Uniprot | |
K161 | Ubiquitination | Uniprot | |
K162 | Sumoylation | Uniprot | |
K162 | Ubiquitination | Uniprot | |
K169 | Sumoylation | Uniprot | |
K169 | Ubiquitination | Uniprot | |
S171 | Phosphorylation | Uniprot | |
K176 | Sumoylation | Uniprot | |
K176 | Ubiquitination | Uniprot | |
T181 | Phosphorylation | Uniprot | |
T198 | Phosphorylation | Uniprot | |
K213 | Ubiquitination | Uniprot | |
T260 | Phosphorylation | Uniprot | |
Y272 | Phosphorylation | P12931 (SRC) | Uniprot |
S310 | Phosphorylation | Uniprot |
PTMs - Q96KB5 As Enzyme
Research Backgrounds
Phosphorylates MAP kinase p38. Seems to be active only in mitosis. May also play a role in the activation of lymphoid cells. When phosphorylated, forms a complex with TP53, leading to TP53 destabilization and attenuation of G2/M checkpoint during doxorubicin-induced DNA damage.
Phosphorylated; in a cell-cycle dependent manner at mitosis.
Expressed in the testis and placenta. In the testis, restrictedly expressed in outer cell layer of seminiferous tubules.
Interacts with DLG1 and TP53.
Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.