Product: Phospho-Serotonin transporter (Thr276) Antibody
Catalog: AF3684
Description: Rabbit polyclonal antibody to Phospho-Serotonin transporter (Thr276)
Application: ELISA(peptide)
Reactivity: Human, Mouse, Rat
Mol.Wt.: 70kD(Calculated).
Uniprot: P31645
RRID: AB_2846998

View similar products>>

   Size Price Inventory
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Polyclonal
Specificity:
Phospho-Serotonin transporter (Thr276) Antibody detects endogenous levels of Serotonin transporter only when phosphorylated at Thr276.
RRID:
AB_2846998
Cite Format: Affinity Biosciences Cat# AF3684, RRID:AB_2846998.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

5 HTT; 5 HTTLPR; 5 hydroxytryptamine (serotonin) transporter; 5 hydroxytryptamine transporter; 5HT transporter; 5HTT; hSERT; HTT; Na+/Cl- dependent serotonin transporter; OCD1; SC6A4_HUMAN; Serotonin transporter 1; SERT; SERT1; Slc6a4; Sodium dependent serotonin transporter; Sodium-dependent serotonin transporter; Solute carrier family 6 (neurotransmitter transporter) member 4; solute carrier family 6 (neurotransmitter transporter, serotonin), member 4; Solute carrier family 6 member 4;

Immunogens

Immunogen:

A synthesized peptide derived from human Serotonin transporter around the phosphorylation site of Thr276.

Uniprot:
Gene(ID):
Expression:
P31645 SC6A4_HUMAN:

Expressed in platelets (at protein level).

Sequence:
METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAV

Research Backgrounds

Function:

Serotonin transporter whose primary function in the central nervous system involves the regulation of serotonergic signaling via transport of serotonin molecules from the synaptic cleft back into the pre-synaptic terminal for re-utilization. Plays a key role in mediating regulation of the availability of serotonin to other receptors of serotonergic systems. Terminates the action of serotonin and recycles it in a sodium-dependent manner.

PTMs:

Glycosylated; modification with sialylated N-glycans is a requirement for transporters to associate with each other and to function as homooligomeric forms.

Phosphorylation at Thr-276 increases 5-HT uptake and is required for cGMP-mediated SERT regulation. Phosphorylation upon PKC stimulation modifies the SERT distribution and density in the membrane, and diminishes the uptake capacity.

Subcellular Location:

Cell membrane>Multi-pass membrane protein. Endomembrane system>Multi-pass membrane protein. Endosome membrane>Multi-pass membrane protein. Cell junction>Synapse. Cell junction>Focal adhesion.
Note: Could be part of recycling endosomes (PubMed:18227069, PubMed:16870614). Density of transporter molecules on the plasma membrane is itself regulated by STX1A (By similarity). Density of transporter molecules on the plasma membrane is also regulated by serotonin (PubMed:17506858) (PubMed:18227069). Density of transporter molecules seems to be modulated by ITGAV:ITGB3 (By similarity).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in platelets (at protein level).

Family&Domains:

Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A4 subfamily.

Research Fields

· Organismal Systems > Nervous system > Serotonergic synapse.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.