Product: Phospho-Rab3A (Thr86) Antibody
Catalog: AF3707
Description: Rabbit polyclonal antibody to Phospho-Rab3A (Thr86)
Application: IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 25kD(Calculated).
Uniprot: P20336
RRID: AB_2847021

View similar products>>

   Size Price Inventory
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Phospho-Rab3A (Thr86) Antibody detects endogenous levels of Rab3A only when phosphorylated at Thr86.
RRID:
AB_2847021
Cite Format: Affinity Biosciences Cat# AF3707, RRID:AB_2847021.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Rab 3A; RAB 3A member RAS oncogene family; Rab3a; RAB3A member RAS oncogene family; RAB3A_HUMAN; RAS associated protein RAB 3A; RAS associated protein RAB3A; Ras related protein Rab 3A; Ras related protein Rab3A; Ras-related protein Rab-3A;

Immunogens

Immunogen:

A synthesized peptide derived from human Rab3A around the phosphorylation site of Thr86.

Uniprot:
Gene(ID):
Expression:
P20336 RAB3A_HUMAN:

Specifically expressed in brain.

Sequence:
MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC

Research Backgrounds

Function:

Small GTP-binding protein that plays a central role in regulated exocytosis and secretion. Controls the recruitment, tethering and docking of secretory vesicles to the plasma membrane (By similarity). Upon stimulation, switches to its active GTP-bound form, cycles to vesicles and recruits effectors such as RIMS1, RIMS2, Rabphilin-3A/RPH3A, RPH3AL or SYTL4 to help the docking of vesicules onto the plasma membrane (By similarity). Upon GTP hydrolysis by GTPase-activating protein, dissociates from the vesicle membrane allowing the exocytosis to proceed (By similarity). Stimulates insulin secretion through interaction with RIMS2 or RPH3AL effectors in pancreatic beta cells (By similarity). Regulates calcium-dependent lysosome exocytosis and plasma membrane repair (PMR) via the interaction with 2 effectors, SYTL4 and myosin-9/MYH9. Acts as a positive regulator of acrosome content secretion in sperm cells by interacting with RIMS1. Plays also a role in the regulation of dopamine release by interacting with synaptotagmin I/SYT (By similarity).

PTMs:

Phosphorylation of Thr-86 in the switch II region by LRRK2 prevents the association of RAB regulatory proteins, including CHM, CHML and RAB GDP dissociation inhibitors GDI1 and GDI2.

Subcellular Location:

Cytoplasm>Cytosol. Lysosome. Cytoplasmic vesicle>Secretory vesicle. Cell membrane>Lipid-anchor>Cytoplasmic side.
Note: Cycles between a vesicle-associated GTP-bound form and a cytosolic GDP-bound form.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Specifically expressed in brain.

Family&Domains:

Belongs to the small GTPase superfamily. Rab family.

Research Fields

· Organismal Systems > Nervous system > Synaptic vesicle cycle.

· Organismal Systems > Endocrine system > Insulin secretion.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.