Phospho-EIF3J (Ser127) Antibody - #AF3761
Product: | Phospho-EIF3J (Ser127) Antibody |
Catalog: | AF3761 |
Description: | Rabbit polyclonal antibody to Phospho-EIF3J (Ser127) |
Application: | IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 29kD(Calculated). |
Uniprot: | O75822 |
RRID: | AB_2847075 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF3761, RRID:AB_2847075.
Fold/Unfold
eIF 3 alpha; eIF-3-alpha; eIF3 alpha; eIF3 p35; eIF3j; EIF3J_HUMAN; EIF3S 1; EIF3S1; Eukaryotic translation initiation factor 3 subunit 1; Eukaryotic translation initiation factor 3 subunit J; Eukaryotic translation initiation factor 3, subunit 1 (alpha, 35kD); Eukaryotic translation initiation factor 3, subunit 1 alpha, 35kD;
Immunogens
A synthesized peptide derived from human EIF3J around the phosphorylation site of Ser127.
- O75822 EIF3J_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM
Research Backgrounds
Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression.
Phosphorylated. Phosphorylation is enhanced upon serum stimulation.
Cytoplasm.
Belongs to the eIF-3 subunit J family.
Research Fields
· Genetic Information Processing > Translation > RNA transport.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.