Product: PIN4 Antibody
Catalog: AF6511
Description: Rabbit polyclonal antibody to PIN4
Application: WB
Reactivity: Human, Mouse, Rat
Mol.Wt.: 15kD,40kD; 14kD(Calculated).
Uniprot: Q9Y237
RRID: AB_2847235

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
PIN4 Antibody detects endogenous levels of total PIN4.
RRID:
AB_2847235
Cite Format: Affinity Biosciences Cat# AF6511, RRID:AB_2847235.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

EPVH; Eukaryotic parvulin homolog; hEPVH; hPar14; hPar17; MGC138486; OTTHUMP00000023527; OTTHUMP00000217483; OTTHUMP00000217485; Par14; Par17; Parvulin 14; Parvulin-14; Parvulin-17; Peptidyl prolyl cis trans isomerase NIMA interacting 4; Peptidyl prolyl cis/trans isomerase EPVH; Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4; Peptidyl-prolyl cis-trans isomerase PIN4; Peptidyl-prolyl cis/trans isomerase EPVH; PIN4; PIN4_HUMAN; PPIase Pin4; Protein (peptidylprolyl cis/trans isomerase) NIMA interacting, 4 (parvulin); Rotamase Pin4;

Immunogens

Immunogen:

A synthesized peptide derived from human PIN4.

Uniprot:
Gene(ID):
Expression:
Q9Y237 PIN4_HUMAN:

Isoform 2 is much more stable than isoform 1 (at protein level). Ubiquitous. Isoform 1 and isoform 2 are expressed in kidney, liver, blood vessel, brain, mammary gland, skeletal muscle, small intestine and submandibularis. Isoform 1 transcripts are much more abundant than isoform 2 in each tissue analyzed.

Sequence:
MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK

Research Backgrounds

Function:

Isoform 1 is involved as a ribosomal RNA processing factor in ribosome biogenesis. Binds to tightly bent AT-rich stretches of double-stranded DNA.

Isoform 2 binds to double-stranded DNA.

PTMs:

Phosphorylated. Isoform 1 phosphorylation occurs both in the nucleus and the cytoplasm. Isoform 1 phosphorylation at Ser-19 does not affect its PPIase activity but is required for nuclear localization, and the dephosphorylation is a prerequisite for the binding to DNA. The unphosphorylated isoform 1 associates with the pre-rRNP complexes in the nucleus.

Isoform 2 is sumoylated with SUMO2 and SUMO3.

Subcellular Location:

Nucleus>Nucleolus. Cytoplasm>Cytoskeleton>Spindle. Cytoplasm.
Note: Colocalizes in the nucleolus during interphase and on the spindle apparatus during mitosis with NPM1.

Mitochondrion. Mitochondrion matrix.
Note: Imported in a time- and membrane potential-dependent manner to the mitochondrial matrix, but without concomitant processing of the protein. Directed to mitochondria by a novel N-terminal domain that functions as non-cleavable mitochondrial targeting peptide.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Isoform 2 is much more stable than isoform 1 (at protein level). Ubiquitous. Isoform 1 and isoform 2 are expressed in kidney, liver, blood vessel, brain, mammary gland, skeletal muscle, small intestine and submandibularis. Isoform 1 transcripts are much more abundant than isoform 2 in each tissue analyzed.

Family&Domains:

The PPIase domain enhances mitochondrial targeting.

Belongs to the PpiC/parvulin rotamase family. PIN4 subfamily.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.