Product: RAD18 Antibody
Catalog: AF6530
Description: Rabbit polyclonal antibody to RAD18
Application: ELISA(peptide)
Reactivity: Human
Mol.Wt.: 80~100kDa; 56kD(Calculated).
Uniprot: Q9NS91
RRID: AB_2847254

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
RAD18 Antibody detects endogenous levels of total RAD18.
RRID:
AB_2847254
Cite Format: Affinity Biosciences Cat# AF6530, RRID:AB_2847254.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

2810024C04Rik; DNA repair protein rad18; E3 ubiquitin-protein ligase RAD18; EC 6.3.2.-; hHR 18; hHR18; hRAD 18; hRAD18; MGC156682; Postreplication repair E3 ubiquitin-protein ligase RAD18; Postreplication repair protein hRAD18p; Postreplication repair protein RAD18; RAD 18; RAD18; RAD18 homolog (S. cerevisiae); RAD18 homolog; RAD18 S. cerevisiae homolog; RAD18 S. cerevisiae homolog of; RAD18 transcript variant; RAD18_HUMAN; Rad18sc; Radiation sensitivity protein 18; RING finger protein 73; RNF 73; RNF73; Structural maintenance of chromosomes protein 6; YCR066W; YCR66W;

Immunogens

Immunogen:

A synthesized peptide derived from human RAD18.

Uniprot:
Gene(ID):
Sequence:
MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVREIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEISPRQNRRTRAAESAEIEPRNKRNRN

Research Backgrounds

Function:

E3 ubiquitin-protein ligase involved in postreplication repair of UV-damaged DNA. Postreplication repair functions in gap-filling of a daughter strand on replication of damaged DNA. Associates to the E2 ubiquitin conjugating enzyme UBE2B to form the UBE2B-RAD18 ubiquitin ligase complex involved in mono-ubiquitination of DNA-associated PCNA on 'Lys-164'. Has ssDNA binding activity.

Subcellular Location:

Nucleus. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome.
Note: Associates with chromatin (PubMed:25931565). Colocalizes with SLF1 in the nucleus and to centrosomes (PubMed:15632077). Relocalizes with SLF1 to nuclear foci in response to DNA damage (PubMed:22036607). Accumulates with the SLF1-SLF2 and SMC5-SMC6 complexes at replication-coupled DNA interstrand repair and DNA double-strand breaks (DSBs) sites on chromatin in a ubiquitin-dependent manner (PubMed:25931565).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the RAD18 family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.