CRTC3 Antibody - #AF6576

(1)  
Product: CRTC3 Antibody
Catalog: AF6576
Description: Rabbit polyclonal antibody to CRTC3
Application: WB
Reactivity: Human, Mouse, Rat
Mol.Wt.: 67kD(Calculated).
Uniprot: Q6UUV7
RRID: AB_2847300

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
CRTC3 Antibody detects endogenous levels of total CRTC3.
RRID:
AB_2847300
Cite Format: Affinity Biosciences Cat# AF6576, RRID:AB_2847300.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CREB regulated transcription coactivator 3; CREB-regulated transcription coactivator 3; CRTC 3; CRTC3; CRTC3_HUMAN; FLJ21868; TORC 3; TORC-3; TORC3; Transducer of CREB protein 3; Transducer of regulated cAMP response element binding protein (CREB) 3; Transducer of regulated cAMP response element binding protein 3; Transducer of regulated cAMP response element-binding protein 3; Transducer of regulated CREB protein 3;

Immunogens

Immunogen:
Uniprot:

Q6UUV7(CRTC3_HUMAN) >>Visit HPA database.

Gene(ID):
CRTC3(64784)
Expression:
Q6UUV7 CRTC3_HUMAN:

Predominantly expressed in B and T lymphocytes. Highest levels in lung. Also expressed in brain, colon, heart, kidney, ovary, and prostate. Weak expression in liver, pancreas, muscle, small intestine, spleen and stomach.

Sequence:
MAASPGSGSANPRKFSEKIALHTQRQAEETRAFEQLMTDLTLSRVQFQKLQQLRLTQYHGGSLPNVSQLRSSASEFQPSFHQADNVRGTRHHGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALNRTNSDSALHTSALSTKPQDPYGGGGQSAWPAPYMGFCDGENNGHGEVASFPGPLKEENLLNVPKPLPKQLWETKEIQSLSGRPRSCDVGGGNAFPHNGQNLGLSPFLGTLNTGGSLPDLTNLHYSTPLPASLDTTDHHFGSMSVGNSVNNIPAAMTHLGIRSSSGLQSSRSNPSIQATLNKTVLSSSLNNHPQTSVPNASALHPSLRLFSLSNPSLSTTNLSGPSRRRQPPVSPLTLSPGPEAHQGFSRQLSSTSPLAPYPTSQMVSSDRSQLSFLPTEAQAQVSPPPPYPAPQELTQPLLQQPRAPEAPAQQPQAASSLPQSDFQLLPAQGSSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSNCGSLPNTILPEDSSTSLFKDLNSALAGLPEVSLNVDTPFPLEEELQIEPLSLDGLNMLSDSSMGLLDPSVEETFRADRL

PTMs - Q6UUV7 As Substrate

Site PTM Type Enzyme
S4 Phosphorylation
K18 Sumoylation
K18 Ubiquitination
T56 Phosphorylation
Y58 Phosphorylation
S62 Phosphorylation P57059 (SIK1)
S67 Phosphorylation
R87 Methylation
S99 Phosphorylation
S135 Phosphorylation
K147 Sumoylation
T160 Phosphorylation
S162 Phosphorylation P57059 (SIK1)
K174 Sumoylation
K213 Sumoylation
K222 Sumoylation
K226 Sumoylation
K232 Sumoylation
K232 Ubiquitination
S238 Phosphorylation
S273 Phosphorylation
S305 Phosphorylation
S321 Phosphorylation
S327 Phosphorylation
S329 Phosphorylation P57059 (SIK1)
S332 Phosphorylation
S344 Phosphorylation
S345 Phosphorylation
T352 Phosphorylation
S353 Phosphorylation
S363 Phosphorylation
S368 Phosphorylation
S370 Phosphorylation P57059 (SIK1)
S373 Phosphorylation
S375 Phosphorylation
S380 Phosphorylation
S391 Phosphorylation
T394 Phosphorylation
S396 Phosphorylation
S406 Phosphorylation
S410 Phosphorylation
S411 Phosphorylation
T412 Phosphorylation
S413 Phosphorylation
S432 Phosphorylation
T436 Phosphorylation
S443 Phosphorylation
Y448 Phosphorylation
T455 Phosphorylation
S524 Phosphorylation
T577 Phosphorylation

Research Backgrounds

Function:

Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 with TAF4. Regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. Potent coactivator of PPARGC1A and inducer of mitochondrial biogenesis in muscle cells. Also coactivator for TAX activation of the human T-cell leukemia virus type 1 (HTLV-1) long terminal repeats (LTR).

PTMs:

Phosphorylation/dephosphorylation states of Ser-273 are required for regulating transduction of CREB activity (By similarity). CRTCs/TORCs are inactive when phosphorylated, and active when dephosphorylated at this site (By similarity). May be phosphorylated at Ser-391 by MAPK3/ERK1 and/or MAPK1/ERK2 or by some cyclin-dependent kinases such as CDK1,CDK2 or CDK5. Following adenylyl cyclase activation, dephosphorylated at Ser-162 and Ser-273 resulting in its dissociation from 14-3-3 proteins probably promoting CRTC3 translocation into the nucleus.

Subcellular Location:

Nucleus. Cytoplasm.
Note: Appears to be mainly nuclear (PubMed:15454081). Translocates to the nucleus following adenylyl cyclase or MAP kinase activation (PubMed:30611118).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Predominantly expressed in B and T lymphocytes. Highest levels in lung. Also expressed in brain, colon, heart, kidney, ovary, and prostate. Weak expression in liver, pancreas, muscle, small intestine, spleen and stomach.

Subunit Structure:

Binding, as a tetramer, through its N-terminal region, with the bZIP domain of CREB1 enhances recruitment of TAF4 to the promoter. 'Arg-314' in the bZIP domain of CREB1 is essential for this interaction. Interacts (when phosphorylated at Ser-162 and Se-273) with 14-3-3 proteins. Interacts with YWHAE. Interacts (when phosphorylated at Ser-391) with phosphatase PP2A catalytic subunit PPP2CA and regulatory subunits PPP2R1A and PPP2R2A. Interacts, via the N-terminal with the ankyrin repeats of BCL3, to form a complex with CREB1 on CRE and TxRE responsive elements and represses HTLV-1 LTR-mediated transcription.

(Microbial infection) Interacts with HTLV-1 protein Tax; this interaction enhances tax transcriptional activity.

Family&Domains:

Belongs to the TORC family.

Research Fields

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.