CDC16/APC6 Antibody | Affinity Biosciences

1/1

CDC16/APC6 Antibody - Western blot analysis of extracts from Raji cells(serum starvation treatment), using CDC16/APC6 Antibody.

Product:	CDC16/APC6 Antibody
Catalog:	AF6608
Description:	Rabbit polyclonal antibody to CDC16/APC6
Application:	WB
Reactivity:	Human, Mouse, Rat
Mol.Wt.:	72kD(Calculated).
Uniprot:	Q13042
RRID:	AB_2847332

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Clonality:

Polyclonal

Specificity:

CDC16/APC6 Antibody detects endogenous levels of total CDC16/APC6.

RRID:

AB_2847332
Cite Format: Affinity Biosciences Cat# AF6608, RRID:AB_2847332.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

ANAPC6; Anaphase promoting complex subunit 6; Anaphase-promoting complex subunit 6; Apc 6; APC6; CDC 16; CDC16 (cell division cycle 16 S. cerevisiae homolog); Cdc16; CDC16 homolog; CDC16 protein; CDC16_HUMAN; CDC16Hs; Cell division cycle 16; Cell division cycle 16 homolog; Cell division cycle protein 16 homolog; CUT9; Cyclosome subunit 6;

Immunogens

Immunogen:

A synthesized peptide derived from human CDC16/APC6.

Uniprot:

Q13042(CDC16_HUMAN) >>Visit HPA database.

Gene(ID):

CDC16(8881)

Sequence:

Q13042 CDC16_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST

PTMs - Q13042 As Substrate

Q13042

Site	PTM Type	Enzyme	Source
T50	Phosphorylation		Uniprot
Y53	Phosphorylation		Uniprot
K101	Ubiquitination		Uniprot
K106	Ubiquitination		Uniprot
K109	Ubiquitination		Uniprot
S112	Phosphorylation	P06493 (CDK1) , P53350 (PLK1)	Uniprot
K115	Ubiquitination		Uniprot
K129	Ubiquitination		Uniprot
K138	Ubiquitination		Uniprot
K154	Ubiquitination		Uniprot
K192	Ubiquitination		Uniprot
K208	Ubiquitination		Uniprot
T254	Phosphorylation		Uniprot
K260	Ubiquitination		Uniprot
S324	Phosphorylation		Uniprot
K325	Ubiquitination		Uniprot
T327	Phosphorylation		Uniprot
T328	Phosphorylation		Uniprot
S396	Phosphorylation		Uniprot
T420	Phosphorylation		Uniprot
K423	Ubiquitination		Uniprot
K433	Ubiquitination		Uniprot
T440	Phosphorylation		Uniprot
K443	Ubiquitination		Uniprot
K460	Ubiquitination		Uniprot
S490	Phosphorylation		Uniprot
K553	Ubiquitination		Uniprot
K556	Ubiquitination		Uniprot
S560	Phosphorylation	P06493 (CDK1)	Uniprot
K572	Ubiquitination		Uniprot
T581	Phosphorylation	P06493 (CDK1)	Uniprot
S586	Phosphorylation		Uniprot
T589	Phosphorylation		Uniprot
S595	Phosphorylation		Uniprot
T599	Phosphorylation		Uniprot
S607	Phosphorylation		Uniprot
S614	Phosphorylation		Uniprot

Research Backgrounds

Q13042_CDC16_HUMAN

Function:

Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.

PTMs:

Phosphorylated. Phosphorylation on Ser-560 occurs specifically during mitosis.

Subcellular Location:

Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cytoplasm>Cytoskeleton>Spindle.
Note: Colocalizes with CDC27 to the centrosome at all stages of the cell cycle and to the mitotic spindle.

Subunit Structure:

V-shaped homodimer. The mammalian APC/C is composed at least of 14 distinct subunits ANAPC1, ANAPC2, CDC27/APC3, ANAPC4, ANAPC5, CDC16/APC6, ANAPC7, CDC23/APC8, ANAPC10, ANAPC11, CDC26/APC12, ANAPC13, ANAPC15 and ANAPC16 that assemble into a complex of at least 19 chains with a combined molecular mass of around 1.2 MDa; APC/C interacts with FZR1 and FBXO5. Interacts with PPP5C and CDC20. Interacts with CDC26.

Family&Domains:

TPR repeats 1-7 mediate homodimerization, while the C-terminal TPR repeats bind to CDC26, burying its hydrophobic N-terminus.

Belongs to the APC6/CDC16 family.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)

· Cellular Processes > Cell growth and death > Oocyte meiosis. (View pathway)

· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis. (View pathway)

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

CDC16/APC6 Antibody - #AF6608