Product: MCL1 Antibody
Catalog: AF6613
Description: Rabbit polyclonal antibody to MCL1
Application: WB ELISA(peptide)
Reactivity: Human, Mouse, Rat
Mol.Wt.: 37kD(Calculated).
Uniprot: Q07820
RRID: AB_2847336

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
MCL1 Antibody detects endogenous levels of total MCL1.
RRID:
AB_2847336
Cite Format: Affinity Biosciences Cat# AF6613, RRID:AB_2847336.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Bcl 2 related protein EAT/mcl1; Bcl-2-like protein 3; Bcl-2-related protein EAT/mcl1; BCL2 related; Bcl2-L-3; BCL2L3; EAT; Induced myeloid leukemia cell differentiation protein Mcl 1; Induced myeloid leukemia cell differentiation protein Mcl-1; MCL 1; MCL1; MCL1-ES; mcl1/EAT; MCL1_HUMAN; MCL1L; MCL1S; MGC104264; MGC1839; Myeloid Cell Leukemia 1; Myeloid cell leukemia ES; Myeloid cell leukemia sequence 1; Myeloid cell leukemia sequence 1 BCL2 related; Myeloid cell leukemia sequence 1 isoform 1; OTTHUMP00000032794; OTTHUMP00000032795; TM;

Immunogens

Immunogen:

A synthesized peptide derived from human MCL1.

Uniprot:
Gene(ID):
Sequence:
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR

Research Backgrounds

Function:

Involved in the regulation of apoptosis versus cell survival, and in the maintenance of viability but not of proliferation. Mediates its effects by interactions with a number of other regulators of apoptosis. Isoform 1 inhibits apoptosis. Isoform 2 promotes apoptosis.

PTMs:

Cleaved by CASP3 during apoptosis. In intact cells cleavage occurs preferentially after Asp-127, yielding a pro-apoptotic 28 kDa C-terminal fragment.

Rapidly degraded in the absence of phosphorylation on Thr-163 in the PEST region.

Phosphorylated on Ser-159, by GSK3, in response to IL3/interleukin-3 withdrawal. Phosphorylation at Ser-159 induces ubiquitination and proteasomal degradation, abrogating the anti-apoptotic activity. Treatment with taxol or okadaic acid induces phosphorylation on additional sites.

Ubiquitinated. Ubiquitination is induced by phosphorylation at Ser-159.

Subcellular Location:

Membrane>Single-pass membrane protein. Cytoplasm. Mitochondrion. Nucleus>Nucleoplasm.
Note: Cytoplasmic, associated with mitochondria.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the Bcl-2 family.

Research Fields

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.