Ring1A Antibody - #AF4074
| Product: | Ring1A Antibody |
| Catalog: | AF4074 |
| Description: | Rabbit polyclonal antibody to Ring1A |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Horse, Sheep, Dog |
| Mol.Wt.: | 58kd; 42kD(Calculated). |
| Uniprot: | Q06587 |
| RRID: | AB_2835050 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF4074, RRID:AB_2835050.
Fold/Unfold
Ring1A; E3 ubiquitin-protein ligase RING1; Polycomb complex protein RING1; Really interesting new gene 1 protein; RING finger protein 1; Ring1; RING1_HUMAN; RING1A; Rnf1; Transcription repressor Ring1A;
Immunogens
- Q06587 RING1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAPKRPRGGGAGGSSVGTGGGGTGGVGGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q06587 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T2 | Phosphorylation | Uniprot | |
| T3 | Phosphorylation | Uniprot | |
| S11 | Phosphorylation | Uniprot | |
| K12 | Ubiquitination | Uniprot | |
| Y19 | Phosphorylation | Uniprot | |
| T24 | Phosphorylation | Uniprot | |
| T33 | Phosphorylation | Uniprot | |
| S38 | Phosphorylation | Uniprot | |
| K62 | Ubiquitination | Uniprot | |
| S96 | Phosphorylation | Uniprot | |
| Y117 | Phosphorylation | Uniprot | |
| S138 | Phosphorylation | Uniprot | |
| S139 | Phosphorylation | Uniprot | |
| S140 | Phosphorylation | Uniprot | |
| S187 | Phosphorylation | Uniprot | |
| S188 | Phosphorylation | Uniprot | |
| S190 | Phosphorylation | Uniprot | |
| R202 | Methylation | Uniprot | |
| S211 | Phosphorylation | Uniprot | |
| T215 | Phosphorylation | Uniprot | |
| T220 | Phosphorylation | Uniprot | |
| S229 | Phosphorylation | Uniprot | |
| S232 | Phosphorylation | Uniprot | |
| T238 | Phosphorylation | Uniprot | |
| S248 | Phosphorylation | Uniprot | |
| S254 | Phosphorylation | Uniprot | |
| K275 | Ubiquitination | Uniprot | |
| K285 | Ubiquitination | Uniprot | |
| K297 | Acetylation | Uniprot | |
| K297 | Ubiquitination | Uniprot | |
| C398 | S-Nitrosylation | Uniprot | |
| T402 | Phosphorylation | Uniprot | |
| K403 | Ubiquitination | Uniprot |
Research Backgrounds
Constitutes one of the E3 ubiquitin-protein ligases that mediate monoubiquitination of 'Lys-119' of histone H2A, thereby playing a central role in histone code and gene regulation. H2A 'Lys-119' ubiquitination gives a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation of female mammals. Essential component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility. Compared to RNF2/RING2, it does not have the main E3 ubiquitin ligase activity on histone H2A, and it may rather act as a modulator of RNF2/RING2 activity.
Nucleus. Nucleus speckle.
Component of chromatin-associated Polycomb (PcG) complexes. Interacts with BMI1 (By similarity). Part of the E2F6.com-1 complex in G0 phase composed of E2F6, MGA, MAX, TFDP1, CBX3, BAT8, EUHMTASE1, RING1, RNF2/RING2 MBLR, L3MBTL2 and YAF2. Interacts with CBX2 and PCGF6. Component of a PRC1-like complex. Component of repressive BCOR complex containing Polycomb group subcomplex at least composed of RYBP, PCGF1, BCOR and RNF2/RING2. Interacts with PCGF2, RNF2; CBX6, CBX7 and CBX8. Interacts with PHC2 (By similarity).
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.