Product: Phospho-HP1 alpha (Ser92) Antibody
Catalog: AF3957
Description: Rabbit polyclonal antibody to Phospho-HP1 alpha (Ser92)
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 22kD(Calculated).
Uniprot: P45973
RRID: AB_2847680

View similar products>>

   Size Price Inventory
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Phospho-HP1 alpha (Ser92) Antibody detects endogenous levels of HP1 alpha only when phosphorylated at Ser92.
RRID:
AB_2847680
Cite Format: Affinity Biosciences Cat# AF3957, RRID:AB_2847680.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Antigen p25; CBX5; CBX5_HUMAN; CG8409; Chromobox 5; Chromobox homolog 5 (HP1 alpha homolog, Drosophila); Chromobox homolog 5; Chromobox protein homolog 5; Epididymis luminal protein 25; HEL25; Heterochromatin protein 1 alpha; Heterochromatin protein 1; Heterochromatin protein 1 homolog alpha; HP1 alpha; HP1 alpha homolog; HP1; HP1A; HP1Hs alpha; Su(var)205;

Immunogens

Immunogen:

A synthesized peptide derived from human HP1 alpha around the phosphorylation site of Ser92.

Uniprot:
Gene(ID):
Sequence:
MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS

Research Backgrounds

Function:

Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). Can interact with lamin-B receptor (LBR). This interaction can contribute to the association of the heterochromatin with the inner nuclear membrane. Involved in the formation of functional kinetochore through interaction with MIS12 complex proteins.

PTMs:

Phosphorylation of HP1 and LBR may be responsible for some of the alterations in chromatin organization and nuclear structure which occur at various times during the cell cycle (By similarity). Phosphorylated during interphase and possibly hyper-phosphorylated during mitosis.

Ubiquitinated.

Subcellular Location:

Nucleus. Chromosome. Chromosome>Centromere.
Note: Colocalizes with HNRNPU in the nucleus (PubMed:19617346). Component of centromeric and pericentromeric heterochromatin. Associates with chromosomes during mitosis. Associates specifically with chromatin during metaphase and anaphase.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.