Product: COL10A1 Antibody
Catalog: DF13756
Description: Rabbit polyclonal antibody to COL10A1
Application: IF/ICC
Cited expt.:
Reactivity: Human, Mouse
Mol.Wt.: 66kD(Calculated).
Uniprot: Q03692

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
COL10A1 Antibody detects endogenous levels of total COL10A1.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

COAA1_HUMAN; Col10a 1; COL10A1; Collagen alpha 1(X) chain; Collagen alpha-1(X) chain; Collagen type X alpha 1 (Schmid metaphyseal chondrodysplasia); Collagen type X alpha 1; Collagen X alpha 1 polypeptide; CollagenX; fa66d11; fb10c08; OTTHUMP00000040411; Procollagen type X alpha 1; Schmid metaphyseal chondrodysplasia; wu:fa66d11; wu:fb10c08;

Immunogens

Immunogen:

A synthesized peptide derived from Human COL10A1.

Uniprot:
Gene(ID):
Sequence:
MLPQIPFLLLVSLNLVHGVFYAERYQMPTGIKGPLPNTKTQFFIPYTIKSKGIAVRGEQGTPGPPGPAGPRGHPGPSGPPGKPGYGSPGLQGEPGLPGPPGPSAVGKPGVPGLPGKPGERGPYGPKGDVGPAGLPGPRGPPGPPGIPGPAGISVPGKPGQQGPTGAPGPRGFPGEKGAPGVPGMNGQKGEMGYGAPGRPGERGLPGPQGPTGPSGPPGVGKRGENGVPGQPGIKGDRGFPGEMGPIGPPGPQGPPGERGPEGIGKPGAAGAPGQPGIPGTKGLPGAPGIAGPPGPPGFGKPGLPGLKGERGPAGLPGGPGAKGEQGPAGLPGKPGLTGPPGNMGPQGPKGIPGSHGLPGPKGETGPAGPAGYPGAKGERGSPGSDGKPGYPGKPGLDGPKGNPGLPGPKGDPGVGGPPGLPGPVGPAGAKGMPGHNGEAGPRGAPGIPGTRGPIGPPGIPGFPGSKGDPGSPGPPGPAGIATKGLNGPTGPPGPPGPRGHSGEPGLPGPPGPPGPPGQAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFSYHVHVKGTHVWVGLYKNGTPVMYTYDEYTKGYLDQASGSAIIDLTENDQVWLQLPNAESNGLYSSEYVHSSFSGFLVAPM

Research Backgrounds

Function:

Type X collagen is a product of hypertrophic chondrocytes and has been localized to presumptive mineralization zones of hyaline cartilage.

PTMs:

Prolines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains.

Subcellular Location:

Secreted>Extracellular space>Extracellular matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location

Research Fields

· Organismal Systems > Digestive system > Protein digestion and absorption.

References

1). Undercarboxylated OCN Inhibits Chondrocyte Hypertrophy and Osteoarthritis Development through GPRC6A/HIF-1α Cascade. International journal of biological sciences, 2025 (PubMed: 40765832) [IF=8.2]

Application: IHC    Species: Mouse    Sample:

Figure 1. OCN deficiency leads to increased chondrocyte hypertrophy. (A) Safranin O and fast green staining of representative paraffin sections of femora of the newborn WT mice. The white boxes depict regions of higher magnification of the hypertrophic zone of the growth plate as shown on the right. The arrows depict the hypertrophic chondrocytes. Statistical analysis of the proportion of relatively hypertrophic chondrocytes is shown on the right. (n = 5 mice per group). (B) Immunohistochemistry (IHC) staining of representative paraffin sections of COL2a1, MMP13 and COL10a1 expression in articular cartilage of WT mice and OCN-/- mice. The black boxes depict regions of higher magnification. Statistical analysis is on the right. (n=7 mice per group). (C) Gene expression analysis of hypertrophic markers of primary chondrocytes isolated from WT and OCN-/- newborn mice after monolayer culture. (D) Gene expression analysis of hypertrophic markers of primary chondrocytes isolated from WT and OCN-/- newborn mice after 3D micromass culture for 21 days. (E) IHC staining of representative paraffin sections of MMP13 and COL10a1 expression in chondrocytes of WT and OCN-/- newborn mice after 3D micromass culture for 21 days. The black boxes depict regions of higher magnification. Grade map visualization displayed by the Slide Viewer software is shown below, red represents the intensity of staining (n=3 per group). Statistical analysis is on the right. Scale bar, 100 μm. WT, wild type. OCN-/-, OCN knockout. Student's t-test for two groups, one-way ANOVA for three or more.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.