PPIL3 Antibody - #DF13771
Product: | PPIL3 Antibody |
Catalog: | DF13771 |
Description: | Rabbit polyclonal antibody to PPIL3 |
Application: | ELISA(peptide) |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 18kD; 18kD(Calculated). |
Uniprot: | Q9H2H8 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
2310076N22Rik; 2510026K04Rik; Ccyclophilin like protein; Cyclophilin J; Cyclophilin like 3; Cyclophilin like protein 3; Cyclophilin like protein PPIL3; Cyclophilin-like protein PPIL3; Cyp10l; CyPJ; MGC105285; Peptidyl prolyl cis trans isomerase like 3; Peptidyl-prolyl cis-trans isomerase-like 3; Peptidylprolyl cis trans isomerase like protein 3; Peptidylprolyl isomerase (cyclophilin) like 3; Peptidylprolyl isomerase like 3; PPIase; PPIase like protein 3; Ppil3; PPIL3_HUMAN; Rotamase; Rotamase PPIL3;
Immunogens
A synthesized peptide derived from Human PPIL3.
- Q9H2H8 PPIL3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFAQ
Research Backgrounds
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved in pre-mRNA splicing.
Ubiquitous. Detected at low levels.
Belongs to the cyclophilin-type PPIase family. PPIL3 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.