IRGM Antibody - #DF13812
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
IFI1; Iigp3; Iipg3; Immunity related GTPase family M protein 1; Immunity related GTPase family, M; Immunity-related GTPase family M protein 1; Immunity-related GTPase family M protein; Interferon inducible protein 1; Interferon-inducible protein 1; Irgm; IRGM_HUMAN; IRGM1; LPS-stimulated RAW 264.7 macrophage protein 47 homolog; LRG 47; LRG-47; LRG-47-like protein; LRG47; MGC149263; MGC149264;
Immunogens
A synthesized peptide derived from Human IRGM.
Widely expressed (at protein level). Expressed in several tissues including colon, small bowel and peripheral blood leukocytes.
- A1A4Y4 IRGM_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY
Research Backgrounds
Putative GTPase which is required for clearance of acute protozoan and bacterial infections. Functions in innate immune response probably through regulation of autophagy. May regulate proinflammatory cytokine production and prevent endotoxemia upon infection. May also play a role in macrophages adhesion and motility (By similarity).
Golgi apparatus membrane. Cell membrane. Cytoplasmic vesicle>Phagosome membrane. Cytoplasmic vesicle>Autophagosome membrane. Cell projection>Phagocytic cup.
Note: Behaves like an integral membrane protein. Recruited to the plasma membrane around forming phagocytic cups, it remains associated with maturing autophagosomes. Preferentially associated with cis- and medial-Golgi.
Widely expressed (at protein level). Expressed in several tissues including colon, small bowel and peripheral blood leukocytes.
The G5 motif of the IRG-type G domain is missing because the IRGM protein is truncated in anthropoids.
Belongs to the TRAFAC class dynamin-like GTPase superfamily. IRG family.
Research Fields
· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.