Product: Syntenin 2 Antibody
Catalog: DF13830
Description: Rabbit polyclonal antibody to Syntenin 2
Application: ELISA(peptide)
Reactivity: Human
Mol.Wt.: 32kD; 32kD(Calculated).
Uniprot: Q9H190

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
Syntenin 2 Antibody detects endogenous levels of total Syntenin 2.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

MDA9; Melanoma differentiation associated gene 9; Pro TGF alpha cytoplasmic domain interacting protein 18; SDCB2_HUMAN; SDCBP2; SITAC; SITAC18; ST 2; Syndecan binding protein (syntenin) 2; Syndecan binding protein 2; Syndecan-binding protein 2; Syntenin-2;

Immunogens

Immunogen:

A synthesized peptide derived from Human Syntenin 2.

Uniprot:
Gene(ID):
Expression:
Q9H190 SDCB2_HUMAN:

Preferentially expressed in cells of the digestive tract (PubMed:11102519). Low expression in skeletal muscle and kidney (PubMed:11102519). Detected in differentiated keratinocytes of normal and malignant epithelium (PubMed:22623796). In healthy skin, expression is localized in suprabasal epidermal layers (PubMed:22623796).

Sequence:
MSSLYPSLEDLKVDQAIQAQVRASPKMPALPVQATAISPPPVLYPNLAELENYMGLSLSSQEVQESLLQIPEGDSTAVSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVLLHHTMDHSIPDA

Research Backgrounds

Function:

Binds phosphatidylinositol 4,5-bisphosphate (PIP2). May play a role in the organization of nuclear PIP2, cell division and cell survival.

Subcellular Location:

Cytoplasm. Nucleus>Nucleolus. Nucleus>Nucleoplasm. Cell membrane. Nucleus speckle.
Note: Associates with intracellular membranes and enriched in the apical region of the cell and in intracellular compartments (PubMed:11102519). Colocalizes with TM4SF1 in the apical region of the cell (PubMed:11102519). Predominantly targeted to nuclear PIP2 pools. Shuttles between several subcellular compartments (PubMed:15961997). PIP2 plays an important role in the distribution of SDCBP2 (PubMed:23300061).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Preferentially expressed in cells of the digestive tract. Low expression in skeletal muscle and kidney. Detected in differentiated keratinocytes of normal and malignant epithelium. In healthy skin, expression is localized in suprabasal epidermal layers.

Family&Domains:

Binds phosphatidylinositol 4,5-bisphosphate (PIP2) via its two PDZ domains. These domains target SDCBP2 to the plasma membranes and nucleoli, two PIP2-rich regions.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.