THEM4 Antibody - #DF13871
| Product: | THEM4 Antibody |
| Catalog: | DF13871 |
| Description: | Rabbit polyclonal antibody to THEM4 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 27kD; 27kD(Calculated). |
| Uniprot: | Q5T1C6 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Acyl CoA thioesterase THEM4; Acyl coenzyme A thioesterase THEM4; C terminal modulator protein; Carboxyl-terminal modulator protein; CTMP; FLJ27206; MGC29636; OTTHUMP00000015248; Them4; THEM4_HUMAN; Thioesterase superfamily member 4;
Immunogens
A synthesized peptide derived from Human THEM4.
Expressed predominantly in skeletal muscle, testis, uterus, brain and kidney. Down-regulated in glioblastoma or glioma compared to non-neoplastic brain due to promoter hypermethylation.
- Q5T1C6 THEM4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLRSCAARLRTLGALCLPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPNPSWNKDLRLLFDQFMKKCEDGSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQGGPYLEGPPGFIHGGAIATMIDATVGMCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFVSCNVQSVDEKTLYSEATSLFIKLNPAKSLT
Research Backgrounds
Has acyl-CoA thioesterase activity towards medium and long-chain (C14 to C18) fatty acyl-CoA substrates, and probably plays a role in mitochondrial fatty acid metabolism. Plays a role in the apoptotic process, possibly via its regulation of AKT1 activity. According to inhibits AKT1 phosphorylation and activity. According to enhances AKT1 activity by favoring its phosphorylation and translocation to plasma membrane.
Phosphorylated.
Cell membrane. Cell projection>Ruffle membrane. Cytoplasm. Mitochondrion. Mitochondrion inner membrane>Peripheral membrane protein. Mitochondrion intermembrane space.
Note: Released from the mitochondria into the cytosol in response to apoptotic stimuli.
Expressed predominantly in skeletal muscle, testis, uterus, brain and kidney. Down-regulated in glioblastoma or glioma compared to non-neoplastic brain due to promoter hypermethylation.
Belongs to the THEM4/THEM5 thioesterase family.
Research Fields
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.