Protease Inhibitor 15 Antibody - #DF13876
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
25 kDa trypsin inhibitor; CRISP-8; CRISP8; Cysteine rich secretory protein 8; Cysteine-rich secretory protein 8; P24TI; p25TI; Peptidase inhibitor 15; PI-15; PI15; PI15_HUMAN; Protease Inhibitor 15; SugarCrisp;
Immunogens
A synthesized peptide derived from Human Protease Inhibitor 15.
Weakly expressed. Expressed at low level in prostate, mammary gland, salivary gland and thyroid gland.
- O43692 PI15_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MIAISAVSSALLFSLLCEASTVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLCFPGVTSNYLYWFK
Research Backgrounds
Serine protease inhibitor which displays weak inhibitory activity against trypsin. May play a role in facial patterning during embryonic development (By similarity).
N-glycosylated.
Secreted.
Weakly expressed. Expressed at low level in prostate, mammary gland, salivary gland and thyroid gland.
Belongs to the CRISP family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.