C22orf32 Antibody - #DF13891
| Product: | C22orf32 Antibody |
| Catalog: | DF13891 |
| Description: | Rabbit polyclonal antibody to C22orf32 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 11kD; 11kD(Calculated). |
| Uniprot: | Q9H4I9 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
C22orf32; Chromosome 22 open reading frame 32; CV032_HUMAN; DDDD; dJ186O1.1; mitochondrial; UPF0466 protein C22orf32;
Immunogens
A synthesized peptide derived from Human C22orf32.
- Q9H4I9 EMRE_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASGAARWLVLAPVRSGALRSGPSLRKDGDVSAAWSGSGRSLVPSRSVIVTRSGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVPEDDDDDD
Research Backgrounds
Essential regulatory subunit of the mitochondrial calcium uniporter complex (uniplex), a complex that mediates calcium uptake into mitochondria. Required to bridge the calcium-sensing proteins MICU1 and MICU2 with the calcium-conducting subunit MCU. Plays a central role in regulating the uniplex complex response to intracellular calcium signaling. Acts by mediating activation of MCU and retention of MICU1 to the MCU pore, in order to ensure tight regulation of the uniplex complex and appropriate responses to intracellular calcium signaling.
Undergoes proteolytic degradation in neurons: degraded by AFG3L2 before SMDT1/EMRE assembly with the uniporter complex, limiting the availability of SMDT1/EMRE for MCU assembly and promoting efficient assembly of gatekeeper subunits with MCU.
Mitochondrion inner membrane>Single-pass membrane protein.
Note: MAIP1 is required to assist sorting of EMRE/SMDT1 into mitochondrion by protecting EMRE/SMDT1 against protein degradation by YME1L1, thereby ensuring SMDT1/EMRE maturation by the mitochondrial processing peptidase (PMPCA and PMPCB) (PubMed:27642048).
Component of the uniplex complex, composed of MCU, MCUB, MICU1, MICU2 and EMRE/SMDT1. Interacts (via the transmembrane region) with MCU (via the first transmembrane region); the interaction is direct. Interacts (via the poly-Asp region) with MICU1 (via polybasic region); the interaction is direct. Interacts (via its C-terminal poly-Asp tail) with MCUR1; the interaction is direct. Unprocessed form interacts (via transit peptide) with MAIP1.
The GXXXX[G/A/S] motif at the C-terminal part of the transmembrane region mediates interaction with MCU and is required to activate the calcium-conducting pore in the uniporter complex.
The poly-Asp region at the C-terminus mediates interaction with the polybasic region of MICU1.
Belongs to the SMDT1/EMRE family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.