OBP2A Antibody - #DF13905
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
hOBPIIa; OBP; OBP2A; OBP2A_HUMAN; OBP2C; OBPIIa; Odorant-binding protein 2a; Odorant-binding protein IIa; Putative odorant binding protein 2c;
Immunogens
A synthesized peptide derived from Human OBP2A.
Strongly expressed in the nasal structures, salivary and lachrymal glands, and lung.
- Q9NY56 OBP2A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYMGKLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH
Research Backgrounds
Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids.
Secreted.
Strongly expressed in the nasal structures, salivary and lachrymal glands, and lung.
Belongs to the calycin superfamily. Lipocalin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.