SLC10A1 Antibody - #DF13906
Product: | SLC10A1 Antibody |
Catalog: | DF13906 |
Description: | Rabbit polyclonal antibody to SLC10A1 |
Application: | ELISA(peptide) |
Reactivity: | Human |
Mol.Wt.: | 38~55kD; 38kD(Calculated). |
Uniprot: | Q14973 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Cell growth-inhibiting gene 29 protein; GIG29; Growth inhibiting protein 29; Na / bile acid cotransporter; Na / taurocholate transport protein; Na(+)/bile acid cotransporter; Na(+)/taurocholate transport protein; Na/taurocholate cotransporting polypeptide; NTCP; NTCP_HUMAN; NTCP1; SLC10A1; Sodium/bile acid cotransporter; Sodium/taurocholate cotransporter polypeptide, hepatic; Sodium/taurocholate cotransporting polypeptide; Solute carrier family 10 (sodium/bile acid cotransporter family) member 1; Solute carrier family 10 member 1;
Immunogens
A synthesized peptide derived from Human SLC10A1.
- Q14973 NTCP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA
Research Backgrounds
The hepatic sodium/bile acid uptake system exhibits broad substrate specificity and transports various non-bile acid organic compounds as well. It is strictly dependent on the extracellular presence of sodium.
(Microbial infection) Acts as a receptor for hepatitis B virus.
Membrane>Multi-pass membrane protein.
(Microbial infection) Interacts with hepatitis B virus large envelope protein.
Belongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.