SRD5A1 Antibody - #DF13930
| Product: | SRD5A1 Antibody |
| Catalog: | DF13930 |
| Description: | Rabbit polyclonal antibody to SRD5A1 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 29kD; 29kD(Calculated). |
| Uniprot: | P18405 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
3 oxo 5 alpha steroid 4 dehydrogenase 1; 3 oxo 5 alpha steroid delta 4 dehydrogenase alpha 1; 3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1,5-alpha reductase; 3-oxo-5-alpha-steroid 4-dehydrogenase 1; 5 alpha reductase; S5A1_HUMAN; S5AR 1; S5AR; SR type 1; SRD5A 1; Srd5a1; Steroid 5 alpha reductase 1; Steroid 5 alpha reductase alpha polypeptide 1 (3 oxo 5 alpha steroid delta 4 dehydrogenase alpha 1); Steroid 5 alpha reductase alpha polypeptide 1; Steroid 5 alpha reductase type I; Steroid 5-alpha-reductase 1;
Immunogens
A synthesized peptide derived from Human SRD5A1.
- P18405 S5A1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF
Research Backgrounds
Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.
Microsome membrane>Multi-pass membrane protein. Endoplasmic reticulum membrane>Multi-pass membrane protein.
Liver and prostate (at a low level).
Belongs to the steroid 5-alpha reductase family.
Research Fields
· Metabolism > Lipid metabolism > Steroid hormone biosynthesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.