Product: SRD5A1 Antibody
Catalog: DF13930
Description: Rabbit polyclonal antibody to SRD5A1
Application: WB ELISA(peptide)
Reactivity: Human, Mouse, Rat
Mol.Wt.: 29-35kD(Observed); 29kD(Calculated).
Uniprot: P18405

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Polyclonal
Specificity:
SRD5A1 Antibody detects endogenous levels of total SRD5A1.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

3 oxo 5 alpha steroid 4 dehydrogenase 1; 3 oxo 5 alpha steroid delta 4 dehydrogenase alpha 1; 3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1,5-alpha reductase; 3-oxo-5-alpha-steroid 4-dehydrogenase 1; 5 alpha reductase; S5A1_HUMAN; S5AR 1; S5AR; SR type 1; SRD5A 1; Srd5a1; Steroid 5 alpha reductase 1; Steroid 5 alpha reductase alpha polypeptide 1 (3 oxo 5 alpha steroid delta 4 dehydrogenase alpha 1); Steroid 5 alpha reductase alpha polypeptide 1; Steroid 5 alpha reductase type I; Steroid 5-alpha-reductase 1;

Immunogens

Immunogen:

A synthesized peptide derived from Human SRD5A1.

Uniprot:
Gene(ID):
Expression:
P18405 S5A1_HUMAN:

Liver and prostate (at a low level).

Sequence:
MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF

Research Backgrounds

Function:

Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.

Subcellular Location:

Microsome membrane>Multi-pass membrane protein. Endoplasmic reticulum membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Liver and prostate (at a low level).

Family&Domains:

Belongs to the steroid 5-alpha reductase family.

Research Fields

· Metabolism > Lipid metabolism > Steroid hormone biosynthesis.

References

1). Molecular mechanism of testicular oxidative stress-induced ferroptosis in Leydig cells caused by cryptorchidism in yak. Theriogenology, 2026 (PubMed: 42008865) [IF=2.4]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.