CRB3 Antibody - #DF13932
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
CRB3; CRUM3_HUMAN; crumbs homolog 3 (Drosophila); Crumbs protein homolog 3; crumbs, Drosophila, homolog of, 3; PRO1158; protein crumbs homolog 3; UNQ588;
Immunogens
A synthesized peptide derived from Human CRB3.
Preferentially expressed in epithelial tissues. Expressed at high levels in lung, kidney, retina, colon and mammary glands. Expressed at moderate levels in liver, spleen, pancreas, placenta and prostate.
- Q9BUF7 CRUM3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQVGARVPPTPNLKLPPEERLI
Research Backgrounds
Involved in the establishment of cell polarity in mammalian epithelial cells. Regulates the morphogenesis of tight junctions.
Apical cell membrane>Single-pass type I membrane protein. Cell junction>Tight junction.
Note: Localizes primarily to the apical membrane with a small fraction in the upper part of tight junctions of epithelial cells.
Preferentially expressed in epithelial tissues. Expressed at high levels in lung, kidney, retina, colon and mammary glands. Expressed at moderate levels in liver, spleen, pancreas, placenta and prostate.
The PDZ-binding motif is involved in the interactions with PARD6A and MPP5.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Tight junction. (View pathway)
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.