Product: ATOX1 Antibody
Catalog: DF13934
Description: Rabbit polyclonal antibody to ATOX1
Application: IHC IF/ICC
Cited expt.: IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 10kD; 7kD(Calculated).
Uniprot: O00244

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
ATOX1 Antibody detects endogenous levels of total ATOX1.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ATOX1; ATOX1_HUMAN; ATX1; ATX1 antioxidant protein 1 homolog (yeast); ATX1 antioxidant protein 1 homolog; Copper transport protein; Copper transport protein ATOX1; HAH1; Metal transport protein; Metal transport protein ATX1; MGC138453; MGC138455;

Immunogens

Immunogen:

A synthesized peptide derived from Human ATOX1.

Uniprot:
Gene(ID):
Expression:
O00244 ATOX1_HUMAN:

Ubiquitous.

Sequence:
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE

Research Backgrounds

Function:

Binds and deliver cytosolic copper to the copper ATPase proteins. May be important in cellular antioxidant defense.

Tissue Specificity:

Ubiquitous.

Family&Domains:

Belongs to the ATX1 family.

Research Fields

· Organismal Systems > Digestive system > Mineral absorption.

References

1). Curcumin suppresses copper accumulation in non-small cell lung cancer by binding ATOX1. BMC pharmacology & toxicology, 2024 (PubMed: 39169392) [IF=2.9]

Application: WB    Species: human    Sample: A549 and H1299 cells

Fig. 1 Effects of curcumin on ATOX1-associated copper chaperones in A549 and H1299 cells. (A) The binding activity between curcumin and ATOX1 protein was analyzed using molecular docking. (B) Cell viability was measured by CCK-8. (C) Levels of ATOX1, ATP7A, and COX17 proteins were measured by western blotting. The levels of proteins were normalized by β-actin. The full-length blots were shown in Supplementary Fig. 1 and Fig. 2. (D) The semi-quantitative analysis of the blots was analyzed by ImageJ software. (E) Effects of DC-AC50 treatment on cell viability. Three parallel experiments were performed in cells. NS no significance. *p 

Application: IHC    Species: human    Sample: A549 cells

Fig. 5 Curcumin inhibited tumor growth by suppressing ATOX1. The animal model was established by injection of A549 cells. After 6 days of injection, the mice were injected with 20 mg/kg/d DC-AC50 or 40 mg/kg/d curcumin by intraperitoneal injection for 21 days. (A) Tumor volume was measured every week. (B) Tumor weight was obtained. Expressions of ATOX1 in tumor tissues were measured by immunohistochemistry (C) and western blotting (D). Black arrows: ATOX1 expression. The full-length blots were presented in Supplementary Fig. 7. Six animals in each group. *p 

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.