SerpinB8 Antibody - #DF13959
Product: | SerpinB8 Antibody |
Catalog: | DF13959 |
Description: | Rabbit polyclonal antibody to SerpinB8 |
Application: | ELISA(peptide) |
Reactivity: | Human, Mouse |
Mol.Wt.: | 43kD(Calculated). |
Uniprot: | P50452 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
CAP 2; CAP-2; CAP2; Cytoplasmic antiproteinase 2; OTTHUMP00000067000; OTTHUMP00000067001; Peptidase inhibitor 8; PI 8; PI-8; PI8; Protease inhibitor 8 (ovalbumin type); Serine (or cysteine) proteinase inhibitor clade B (ovalbumin) member 8; Serpin B8; Serpin peptidase inhibitor clade B (ovalbumin) member 8; Serpinb8; SPB8_HUMAN;
Immunogens
A synthesized peptide derived from Human SerpinB8.
- P50452 SPB8_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVVEKALTYEKFKAWTNSEKLTKSKVQVFLPRLKLEESYDLEPFLRRLGMIDAFDEAKADFSGMSTEKNVPLSKVAHKCFVEVNEEGTEAAAATAVVRNSRCSRMEPRFCADHPFLFFIRHHKTNCILFCGRFSSP
Research Backgrounds
Has an important role in epithelial desmosome-mediated cell-cell adhesion.
Cytoplasm.
Belongs to the serpin family. Ov-serpin subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.