NNT1 Antibody - #DF13973

Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
B cell stimulating factor 3; B-cell-stimulating factor 3; BSF 3; BSF-3; BSF3; Cardiotrophin like cytokine; Cardiotrophin like cytokine factor 1; Cardiotrophin-like cytokine factor 1; CISS 2; CISS2; CLC; CLCF 1; Clcf1; CLCF1_HUMAN; Cold induced sweating syndrome 2; CRLF 1 associated cytokine like factor 1; CRLF1 associated cytokine like factor 1; Neurotrophin 1; Neurotrophin 1/B cell stimulating factor 3; Neurotrophin1; NNT 1; NNT-1; Novel neurotrophin 1; Novel neurotrophin-1; NR 6; NR6;
Immunogens
A synthesized peptide derived from Human NNT1.
Expressed predominantly in lymph nodes, spleen, peripheral blood lymphocytes, bone marrow, and fetal liver.
- Q9UBD9 CLCF1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF
Research Backgrounds
In complex with CRLF1, forms a heterodimeric neurotropic cytokine that plays a crucial role during neuronal development (Probable). Also stimulates B-cells. Binds to and activates the ILST/gp130 receptor.
Secreted.
Expressed predominantly in lymph nodes, spleen, peripheral blood lymphocytes, bone marrow, and fetal liver.
Belongs to the IL-6 superfamily.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.