Product: ABCE1 Antibody
Catalog: DF13990
Description: Rabbit polyclonal antibody to ABCE1
Application: IF/ICC
Reactivity: Human, Mouse
Mol.Wt.: 67kD; 67kD(Calculated).
Uniprot: P61221

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
ABCE1 Antibody detects endogenous levels of total ABCE1.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

2' 5' oligoadenylate binding protein; 2''-5''-oligoadenylate-binding protein; 2'5' oligoadenylate binding protein; ABC 38; ABC38; ABCE 1; ABCE1; ABCE1_HUMAN; ATP binding cassette sub family E (OABP) member 1; ATP binding cassette sub family E member 1; ATP-binding cassette sub-family E member 1; HuHP 68; HuHP68; OABP; Ribonuclease 4 inhibitor; Ribonuclease L (2' 5' oligoisoadenylate synthetase dependent) inhibitor; Ribonuclease L (2'5' oligoisoadenylate synthetase dependent) inhibitor; Ribonuclease L inhibitor; RLI; RNase L inhibitor; RNASEL1; RNASELI; RNS 4I; RNS4I;

Immunogens

Immunogen:

A synthesized peptide derived from Human ABCE1.

Uniprot:
Gene(ID):
Sequence:
MADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCGICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTALKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINPDRYIIVVEHDLSVLDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFLDGYVPTENLRFRDASLVFKVAETANEEEVKKMCMYKYPGMKKKMGEFELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKSTGSVRQLLHEKIRDAYTHPQFVTDVMKPLQIENIIDQEVQTLSGGELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD

Research Backgrounds

Function:

Antagonizes the binding of 2-5A (5'-phosphorylated 2',5'-linked oligoadenylates) by RNase L through direct interaction with RNase L and therefore inhibits its endoribonuclease activity. May play a central role in the regulation of mRNA turnover. Antagonizes the anti-viral effect of the interferon-regulated 2-5A/RNase L pathway. May act as a chaperone for post-translational events during HIV-1 capsid assembly.

Subcellular Location:

Cytoplasm. Mitochondrion.
Note: Localized to clusters of virus formation at the plasma membrane.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Probably heterodimerizes with RNASEL; this interaction inhibits the RNASEL.

(Microbial infection) Interacts with HIV-1 proteins Vif and Gag.

(Microbial infection) Interacts with HIV-2 protein Gag.

Family&Domains:

Belongs to the ABC transporter superfamily. ABCE family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.