REG1 alpha Antibody - #DF14006
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
ICRF; Islet cells regeneration factor; Islet of Langerhans regenerating protein; Lithostathine 1 alpha; Lithostathine 1 alpha precursor; Lithostathine; Lithostathine-1-alpha; MGC12447; P19; Pancreatic stone protein; Pancreatic stone protein secretory; Pancreatic thread protein; Protein X; PSP; PSPS; PSPS1; PTP; RATRGPI; REG; REG-1-alpha; Reg1; REG1A; REG1A_HUMAN; Regenerating islet derived 1 alpha; Regenerating islet derived 1 alpha pancreatic stone protein pancreatic thread protein; Regenerating islet-derived protein 1-alpha; Regenerating protein I alpha;
Immunogens
A synthesized peptide derived from Human REG1 alpha.
In pancreatic acinar cells and, in lower levels, in brain. Enhanced expression of PSP-related transcripts and intraneuronal accumulation of PSP-like proteins is found in brain from Alzheimer disease and Down syndrome patients.
- P05451 REG1A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAQTSSYFMLISCLMFLSQSQGQEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN
Research Backgrounds
Might act as an inhibitor of spontaneous calcium carbonate precipitation. May be associated with neuronal sprouting in brain, and with brain and pancreas regeneration.
The composition of the O-linked carbohydrate on Thr-27 is complex and varied. In the crystallographic structure, the attached sugar appears to be N-acetylglucosamine, typical of an intracellular protein, rather than N-acetylgalactosamine.
Secreted.
In pancreatic acinar cells and, in lower levels, in brain. Enhanced expression of PSP-related transcripts and intraneuronal accumulation of PSP-like proteins is found in brain from Alzheimer disease and Down syndrome patients.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.