beta 4 Defensin Antibody - #DF14053
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
BD 4; BD-4; BD4; beta 104; beta 4 Defensin; Beta defensin 4; Beta-defensin 104; Beta-defensin 4; D104A_HUMAN; DEFB-4; DEFB104B; Defensin; Defensin beta 104; Defensin beta 4 precursor; hBD 4; hBD-4; hBD4;
Immunogens
A synthesized peptide derived from Human beta 4 Defensin.
High expression in the testis. Gastric antrum exhibited relatively high levels. A lower expression is observed in uterus and neutrophils thyroid gland, lung, and kidney. No detectable expression in other tissues tested.
- Q8WTQ1 D104A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQRLVLLLAISLLLYQDLPVRSEFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP
Research Backgrounds
Has antimicrobial activity. Synergistic effects with lysozyme and DEFB103.
Secreted.
High expression in the testis. Gastric antrum exhibited relatively high levels. A lower expression is observed in uterus and neutrophils thyroid gland, lung, and kidney. No detectable expression in other tissues tested.
Belongs to the beta-defensin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.