TIP30 Antibody - #DF14060
| Product: | TIP30 Antibody |
| Catalog: | DF14060 |
| Description: | Rabbit polyclonal antibody to TIP30 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 30,35kD; 27kD(Calculated). |
| Uniprot: | Q9BUP3 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
30 kDa HIV 1 TAT interacting protein; 30 kDa HIV-1 TAT-interacting protein; 30 kDa HIV1 TAT interacting protein; CC3; FLJ26963; HIV 1 Tat interacting protein 2 30kDa; HIV 1 Tat interacting protein 2; HIV-1 TAT-interactive protein 2; HTAI2_HUMAN; HTATIP 2; HTATIP2; Oxidoreductase HTATIP2; SDR44U1; Short chain dehydrogenase/reductase family 44U member 1; Tat interacting protein (30kDa);
Immunogens
A synthesized peptide derived from Human TIP30.
Ubiquitous. Highest level in liver. High levels in lung, skeletal muscle, pancreas and placenta. Moderate levels in heart and kidney. Low levels in brain. Not expressed or low levels in variant small cell lung carcinomas, 33% of hepatocellular carcinomas and neuroblastomas.
- Q9BUP3 HTAI2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWASGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP
Research Backgrounds
Oxidoreductase required for tumor suppression. NAPDH-bound form inhibits nuclear import by competing with nuclear import substrates for binding to a subset of nuclear transport receptors. May act as a redox sensor linked to transcription through regulation of nuclear import. Isoform 1 is a metastasis suppressor with proapoptotic as well as antiangiogenic properties. Isoform 2 has an antiapoptotic effect.
Cytoplasm. Nucleus envelope.
Ubiquitous. Highest level in liver. High levels in lung, skeletal muscle, pancreas and placenta. Moderate levels in heart and kidney. Low levels in brain. Not expressed or low levels in variant small cell lung carcinomas, 33% of hepatocellular carcinomas and neuroblastomas.
Unique C-terminus confers high proteasome-dependent instability to isoform 2.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.