Product: GPCR TGR5 Antibody
Catalog: DF14067
Description: Rabbit polyclonal antibody to GPCR TGR5
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat, Zebrafish
Mol.Wt.: 35kD; 35kD(Calculated).
Uniprot: Q8TDU6

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Zebrafish
Clonality:
Polyclonal
Specificity:
GPCR TGR5 Antibody detects endogenous levels of total GPCR TGR5.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

BG 37; BG37; G protein coupled bile acid receptor 1; G protein coupled bile acid receptor BG 37; G protein coupled bile acid receptor BG37; G-protein coupled bile acid receptor 1; G-protein coupled receptor GPCR19; GPBAR 1; GPBAR_HUMAN; GPBAR1; GPCR 19; GPCR; GPCR19; GPR 131; GPR131; hBG 37; hBG37; hGPCR 19; hGPCR19; M BAR; M-BAR; Membrane bile acid receptor; Membrane type receptor for bile acids; Membrane-type receptor for bile acids; MGC40597; TGR 5; TGR5;

Immunogens

Immunogen:

A synthesized peptide derived from Human GPCR TGR5.

Uniprot:
Gene(ID):
Expression:
Q8TDU6 GPBAR_HUMAN:

Ubiquitously expressed. Expressed at higher level in spleen and placenta. Expressed at lower level in other tissues. In digestive tissues, it is expressed in stomach, duodenum, ileocecum, ileum, jejunum, ascending colon, transverse colon, descending colon, cecum and liver, but not in esophagus and rectum.

Sequence:
MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN

Research Backgrounds

Function:

Receptor for bile acid. Bile acid-binding induces its internalization, activation of extracellular signal-regulated kinase and intracellular cAMP production. May be involved in the suppression of macrophage functions by bile acids.

Subcellular Location:

Cell membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitously expressed. Expressed at higher level in spleen and placenta. Expressed at lower level in other tissues. In digestive tissues, it is expressed in stomach, duodenum, ileocecum, ileum, jejunum, ascending colon, transverse colon, descending colon, cecum and liver, but not in esophagus and rectum.

Family&Domains:

Belongs to the G-protein coupled receptor 1 family.

References

1). Lycium barbarum polysaccharide remodels colon inflammatory microenvironment and improves gut health. Heliyon, 2024 (PubMed: 38774318) [IF=4.0]

2). Every-other-day fasting inhibits pyroptosis while regulating bile acid metabolism and activating TGR5 signaling in spinal cord injury. Frontiers in molecular neuroscience, 2024 (PubMed: 39328272) [IF=3.5]

3). Integration of UPLC-MS/MS-based metabolomics and desorption electrospray ionization-mass spectrometry imaging reveals that Shouhui Tongbian Capsule alleviates slow transit constipation by regulating bile acid metabolism. Journal of chromatography. B, Analytical technologies in the biomedical and life sciences, 2024 (PubMed: 39369590) [IF=2.8]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.