Product: GPCR TGR5 Antibody
Catalog: DF14067
Description: Rabbit polyclonal antibody to GPCR TGR5
Application: WB IHC IF/ICC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat, Zebrafish
Mol.Wt.: 35kD(Observed); 35kD(Calculated).
Uniprot: Q8TDU6

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Zebrafish
Clonality:
Polyclonal
Specificity:
GPCR TGR5 Antibody detects endogenous levels of total GPCR TGR5.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

BG 37; BG37; G protein coupled bile acid receptor 1; G protein coupled bile acid receptor BG 37; G protein coupled bile acid receptor BG37; G-protein coupled bile acid receptor 1; G-protein coupled receptor GPCR19; GPBAR 1; GPBAR_HUMAN; GPBAR1; GPCR 19; GPCR; GPCR19; GPR 131; GPR131; hBG 37; hBG37; hGPCR 19; hGPCR19; M BAR; M-BAR; Membrane bile acid receptor; Membrane type receptor for bile acids; Membrane-type receptor for bile acids; MGC40597; TGR 5; TGR5;

Immunogens

Immunogen:

A synthesized peptide derived from Human GPCR TGR5.

Uniprot:
Gene(ID):
Expression:
Q8TDU6 GPBAR_HUMAN:

Ubiquitously expressed. Expressed at higher level in spleen and placenta. Expressed at lower level in other tissues. In digestive tissues, it is expressed in stomach, duodenum, ileocecum, ileum, jejunum, ascending colon, transverse colon, descending colon, cecum and liver, but not in esophagus and rectum.

Sequence:
MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN

Research Backgrounds

Function:

Receptor for bile acid. Bile acid-binding induces its internalization, activation of extracellular signal-regulated kinase and intracellular cAMP production. May be involved in the suppression of macrophage functions by bile acids.

Subcellular Location:

Cell membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitously expressed. Expressed at higher level in spleen and placenta. Expressed at lower level in other tissues. In digestive tissues, it is expressed in stomach, duodenum, ileocecum, ileum, jejunum, ascending colon, transverse colon, descending colon, cecum and liver, but not in esophagus and rectum.

Family&Domains:

Belongs to the G-protein coupled receptor 1 family.

References

1). Synbiotic Intervention with Inulin and Lactiplantibacillus plantarum LPm77 Attenuates Type 2 Diabetes via Enhanced TUDCA Metabolism and Gut-Liver Axis Modulation. Journal of agricultural and food chemistry, 2025 (PubMed: 40708558) [IF=5.7]

2). Lycium barbarum polysaccharide remodels colon inflammatory microenvironment and improves gut health. Heliyon, 2024 (PubMed: 38774318) [IF=4.0]

Application: IHC    Species: Mouse    Sample: colon tissue

Fig. 6 LBP improved BA dysmetabolism in mice with UC. (A) Content of BAs in the five groups. Data are shown as mean ± SEM (n = 6). One-way ANOVA was performed to assess statistically significant differences. *p ≤ 0.05 and **p ≤ 0.01 compared to DSS group. (B) Expression of BAs related to TGR5 in colon tissue with scale bar of 50 μm ( × 10). (C) Correlation of spearman between fecal BAs and intestinal microbiota. Red indicates positive correlation and blue indicates negative correlation. Color intensity is proportionally related to spearman correlation strength. *p ≤ 0.05 and **p ≤ 0.01. LBP: Lycium barbarum polysaccharide; BA: bile acid; DSS: dextran sulfate sodium; TGR5: G-protein-coupled receptor 5

3). Every-other-day fasting inhibits pyroptosis while regulating bile acid metabolism and activating TGR5 signaling in spinal cord injury. Frontiers in molecular neuroscience, 2024 (PubMed: 39328272) [IF=3.5]

Application: WB    Species: Rat    Sample: spinal cord tissue

FIGURE 4 EODF inhibits the NLRP3/Caspase-1/GSDMD pyroptosis pathway and reduce the levels of inflammatory cytokines IL-18 and IL-1β downstream of the pyroptosis pathway while activating TGR5 and suppressing microglia activation. (A–F) Western blotting analysis of TGR5, TMEM119, NLRP3, Caspase-1 and GSDMD expression in spinal cord tissues. (G,H) The levels of inflammatory cytokines IL-18 and IL-1β evaluated by ELISA in three groups of rats. Data are presented as mean ± SD.

4). Integration of UPLC-MS/MS-based metabolomics and desorption electrospray ionization-mass spectrometry imaging reveals that Shouhui Tongbian Capsule alleviates slow transit constipation by regulating bile acid metabolism. Journal of chromatography. B, Analytical technologies in the biomedical and life sciences, 2024 (PubMed: 39369590) [IF=2.8]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.