APM2 Antibody - #DF14083
| Product: | APM2 Antibody |
| Catalog: | DF14083 |
| Description: | Rabbit polyclonal antibody to APM2 |
| Application: | ELISA(peptide) |
| Reactivity: | Human |
| Mol.Wt.: | 8kD(Calculated). |
| Uniprot: | Q15847 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Adipose most abundant gene transcript 2 protein; Adipose specific 2; APM 2; C10orf116; Chromosome 10 open reading frame 116; OTTHUMP00000020019; RP11-96C23.4;
Immunogens
A synthesized peptide derived from Human APM2.
Expressed in adipose tissue (at protein level). Highly expressed in omental and subcutaneous adipose tissues. Expressed in heart, cornea, liver, kidney and spleen.
- Q15847 ADIRF_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASKGLQDLKQQVEGTAQEAVSAAGAAAQQVVDQATEAGQKAMDQLAKTTQETIDKTANQASDTFSGIGKKFGLLK
Research Backgrounds
Plays a role in fat cell development; promotes adipogenic differentiation and stimulates transcription initiation of master adipogenesis factors like PPARG and CEBPA at early stages of preadipocyte differentiation. Its overexpression confers resistance to the anticancer chemotherapeutic drug cisplatin.
Nucleus.
Expressed in adipose tissue (at protein level). Highly expressed in omental and subcutaneous adipose tissues. Expressed in heart, cornea, liver, kidney and spleen.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.