Product: HS3ST1 Antibody
Catalog: DF14125
Description: Rabbit polyclonal antibody to HS3ST1
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 35-50kD; 36kD(Calculated).
Uniprot: O14792

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500, WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
HS3ST1 Antibody detects endogenous levels of total HS3ST1.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

3-OST-1; 3OST; 3OST1; EC 2.8.2.23; h3 OST 1; h3-OST-1; Heparan sulfate (glucosamine) 3 O sulfotransferase 1; Heparan sulfate 3 O sulfotransferase 1; Heparan sulfate 3-O-sulfotransferase 1; Heparan sulfate D glucosaminyl 3 O sulfotransferase 1; Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 1; Heparan sulfate glucosamine 3-O-sulfotransferase 1; Heparin glucosamine 3 O sulfotransferase; HS3S1_HUMAN; HS3ST 1; Hs3st1;

Immunogens

Immunogen:

A synthesized peptide derived from Human HS3ST1.

Uniprot:
Gene(ID):
Expression:
O14792 HS3S1_HUMAN:

Highly expressed in the brain and kidney and weakly expressed in the heart, lung and placenta.

Sequence:
MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH

Research Backgrounds

Function:

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to position 3 of glucosamine residues in heparan. Catalyzes the rate limiting step in the biosynthesis of heparan sulfate (HSact). This modification is a crucial step in the biosynthesis of anticoagulant heparan sulfate as it completes the structure of the antithrombin pentasaccharide binding site.

Subcellular Location:

Golgi apparatus lumen.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly expressed in the brain and kidney and weakly expressed in the heart, lung and placenta.

Family&Domains:

Belongs to the sulfotransferase 1 family.

Research Fields

· Metabolism > Glycan biosynthesis and metabolism > Glycosaminoglycan biosynthesis - heparan sulfate / heparin.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.