HS3ST1 Antibody - #DF14125
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
3-OST-1; 3OST; 3OST1; EC 2.8.2.23; h3 OST 1; h3-OST-1; Heparan sulfate (glucosamine) 3 O sulfotransferase 1; Heparan sulfate 3 O sulfotransferase 1; Heparan sulfate 3-O-sulfotransferase 1; Heparan sulfate D glucosaminyl 3 O sulfotransferase 1; Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 1; Heparan sulfate glucosamine 3-O-sulfotransferase 1; Heparin glucosamine 3 O sulfotransferase; HS3S1_HUMAN; HS3ST 1; Hs3st1;
Immunogens
A synthesized peptide derived from Human HS3ST1.
Highly expressed in the brain and kidney and weakly expressed in the heart, lung and placenta.
- O14792 HS3S1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH
Research Backgrounds
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to position 3 of glucosamine residues in heparan. Catalyzes the rate limiting step in the biosynthesis of heparan sulfate (HSact). This modification is a crucial step in the biosynthesis of anticoagulant heparan sulfate as it completes the structure of the antithrombin pentasaccharide binding site.
Golgi apparatus lumen.
Highly expressed in the brain and kidney and weakly expressed in the heart, lung and placenta.
Belongs to the sulfotransferase 1 family.
Research Fields
· Metabolism > Glycan biosynthesis and metabolism > Glycosaminoglycan biosynthesis - heparan sulfate / heparin.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.