MARVELD1 Antibody - #DF14131
| Product: | MARVELD1 Antibody |
| Catalog: | DF14131 |
| Description: | Rabbit polyclonal antibody to MARVELD1 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 20kD; 19kD(Calculated). |
| Uniprot: | Q9BSK0 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
GB14; MALD1_HUMAN; MARVD1; MARVEL (membrane-associating) domain containing 1; MARVEL domain containing protein 1; MARVEL domain-containing protein 1; MARVELD1; MRVLDC1; Putative MARVEL domain containing protein 1;
Immunogens
A synthesized peptide derived from Human MARVELD1.
- Q9BSK0 MALD1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLPPPPRQPPPQARAARGAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIATSKYQGPVHFALFVSVLFWLLTLGLYFLTLLGKHELVPVLGSRWLMVNVAHDVLAAALYGAATGIMSDQMQRHSYCNLKDYPLPCAYHAFLAAAVCGGVCHGLYLLSALYGCGRRCQGKQEVA
Research Backgrounds
Microtubule-associated protein that exhibits cell cycle-dependent localization and can inhibit cell proliferation and migration.
Cell membrane>Multi-pass membrane protein. Cytoplasm>Cytoskeleton. Nucleus.
Note: Observed in the nucleus and at the perinuclear region during interphase, but localizes at the mitotic spindle and midbody at metaphase. A significant fraction of MARVELD1 translocates to the plasma membrane during anaphase or upon microtubule depolymerization (By similarity).
Widely expressed in normal tissues. Down-regulated in multiple primary tumors.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.