PSCDBP Antibody - #DF14144
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
B3-1; B31; CASP; Cbp HE; CYBR; CYTHIP; Cytip; CYTIP_HUMAN; Cytohesin 1 interacting protein; Cytohesin binder and regulator; Cytohesin-associated scaffolding protein; Cytohesin-binding protein HE; Cytohesin-interacting protein; HE; Pleckstrin Homology Sec7 and Coiled-Coil Domains Binding Protein; Pleckstrin homology Sec7 and coiled-coil domains-binding protein; Pleckstrin homology, Sec7 and coiled/coil domains, binding protein;
Immunogens
A synthesized peptide derived from Human PSCDBP.
Expressed in lymph nodes, thymus, spleen, lung, peripheral blood leukocytes and bone marrow.
- O60759 CYTIP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSLQRLLQHSSNGNLADFCAGPAYSSYSTLTGSLTMDDNRRIQMLADTVATLPRGRKQLALTRSSSLSDFSWSQRKLVTVEKQDNETFGFEIQSYRPQNQNACSSEMFTLICKIQEDSPAHCAGLQAGDVLANINGVSTEGFTYKQVVDLIRSSGNLLTIETLNGTMILKRTELEAKLQVLKQTLKQKWVEYRSLQLQEHRLLHGDAANCPSLENMDLDELSLFGPLPGPGPALVDRNRLSSESSCKSWLSSMTMDSEDGYQTCVSEDSSRGAFSRQTSTDDECFIPKEGDDFLRRSSSRRNRSISNTSSGSMSPLWEGNLSSMFGTLPRKSRKGSVRKQLLKFIPGLHRAVEEEESRF
Research Backgrounds
By its binding to cytohesin-1 (CYTH1), it modifies activation of ARFs by CYTH1 and its precise function may be to sequester CYTH1 in the cytoplasm.
Cytoplasm. Early endosome.
Note: Recruited from the cytosol to endosomes by SNX27.
Expressed in lymph nodes, thymus, spleen, lung, peripheral blood leukocytes and bone marrow.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.